KEGG   Dyadobacter fermentans: Dfer_3793Help
Entry
Dfer_3793         CDS       T00970                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
dfe01230  Biosynthesis of amino acids
Module
dfe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dfer_3793
Enzymes [BR:dfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dfer_3793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ACT94997
UniProt: C6VWG6
Position
4619871..4620689
Genome map
AA seq 272 aa AA seqDB search
MNILEKIIARKQEEISESKKHRTISDLEKEPLFSRPTTSLAAALRSSTTPRIISEFKRKS
PSKGVINGDVQPQIVTRDYVNAGAVGLSVLTDTDFFGGSFADFLAAREANPLIPMLRKDF
IVDEYQLFEAKSIGADVILLIAANLTPSEIAHLSRRAHDLGLEVLLEVHNAEELAVSTGE
HIDIVGVNNRNLKTFETSIETSIELSELIPDQFVKISESGLQDAETIVKLFQYGYKGFLI
GETFMKTANPGAALAGLQQDLTQHSNLNPLVL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttagaaaaaattatcgcccgcaagcaggaagaaatcagcgagtcgaaaaag
cacagaaccatttccgatctggaaaaggagccattgttctcgcgcccaactacttcgctc
gccgcggcactaagatcatctaccacgccccgcattatctcggaatttaaaaggaaatcc
ccttcgaaaggcgttatcaatggcgacgtacagccacagatcgtgacccgggattatgtg
aatgcaggggccgtgggtctttcagtactaaccgataccgactttttcggcggttcgttt
gccgatttcctcgcagcgcgggaagccaatccgctgatcccgatgctccggaaggatttc
atcgtggacgaataccagcttttcgaagccaaatccatcggcgcggacgtgatcctgctc
atcgcagcaaacctcacgccttcggaaatcgcccatttgagccgcagggcgcacgatctc
gggctggaagtgctgctggaagtgcataatgcggaagaactggctgtaagtaccggcgag
catatcgacattgtaggtgtgaacaaccgcaatctcaaaacttttgaaacctccattgaa
acgtcgatcgagcttagcgagctcatccccgatcagtttgtaaagatttcagaaagcggc
ttgcaggacgccgaaaccatcgtgaagctgttccaatacggctataagggatttttgata
ggagaaacatttatgaaaaccgcgaacccgggcgccgcacttgctggtttgcaacaagat
ttaactcaacatagcaatttaaatcctctggttctatga

DBGET integrated database retrieval system