KEGG   Dyadobacter fermentans: Dfer_3795Help
Entry
Dfer_3795         CDS       T00970                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00260  Glycine, serine and threonine metabolism
dfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
dfe01230  Biosynthesis of amino acids
Module
dfe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dfer_3795
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dfer_3795
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dfer_3795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACT94999
UniProt: C6VWG8
Position
4621344..4622543
Genome map
AA seq 399 aa AA seqDB search
MESIAEKKSYQVNDRGYYGTFGGAFIPEMLYPNVEELRENYLQVINDPSFQKEYSDLLRD
YVGRPTPLYRANRLSEKYKTNIFLKREDLCHTGAHKVNNTIGQILMAQRLGKKRIVAETG
AGQHGVATATVCALMNLECTVYMGEIDIERQAPNVARMKMLGAEVRPATSGSRTLKDATN
EAMRHWINNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIRAQLNAHTGKQTPNYVIAC
VGGGSNAAGSFYHFLDDEDVKLVAVEAAGLGLTSGHSAATTALGKPGVLHGSRTILMQTE
DGQVTEPFSISAGLDYPGIGPQHAWLYASGRGTFLSATDDEAVQAAFELTRLEGIIPALE
SSHALAVLGRLGASENETVVLTLSGRGDKDMGTYMKYID
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaatcaattgcagaaaagaagtcgtatcaggtaaatgaccgaggttattatggcact
ttcggaggtgcgttcattcctgaaatgctgtacccgaatgtcgaagagttgcgtgaaaat
tacctgcaagtaatcaacgacccttcttttcagaaagaatacagcgatttgttacgcgat
tacgtaggccgccccacgccgctttaccgcgccaaccggctttcggaaaaatataaaacc
aatatctttctcaaaagggaagacctctgccacaccggcgcgcacaaggtgaataacacc
atcgggcagatcctgatggcgcagcgcctgggcaaaaaacgcattgtagccgaaaccggc
gcaggtcagcacggcgtggccacggctaccgtgtgcgcattgatgaacctcgaatgcacc
gtgtacatgggcgagatcgatatcgagcgccaggcgcccaatgtggcccgcatgaaaatg
ctcggtgcggaagtacgcccggccacctccggctcacgcacattgaaagacgctactaac
gaggccatgcgccattggatcaataacccggtcgatacgcattacattatcggctcagtg
gtaggtccgcacccatatccggatatggtagcgcggttccagtcggttatttccgaagaa
atccgtgcgcagctcaacgcacataccggcaagcaaacgcccaattacgtgatcgcctgc
gtaggcggcggcagcaatgcggcaggctcgttttaccacttcctcgacgatgaagatgtg
aaactcgtagcggtggaagccgcggggcttggccttacttccggccattcggcagctacc
accgcattgggtaagcccggcgtgctccacggaagccgcaccatcctcatgcaaacagaa
gatggccaggtaacggaaccattttccatctccgcggggttggattacccgggcatcggc
cctcagcatgcatggctttacgccagcggccgcggcacattcctttccgcgaccgacgac
gaggcggtgcaggctgcatttgagctgacgcgcctcgaaggcatcatccccgcattggaa
tcatcccacgcactggccgttttgggccgtctgggcgcttccgagaacgaaacggtggta
ctcaccctctcaggccgcggcgacaaggatatgggtacttatatgaaatacatcgattaa

DBGET integrated database retrieval system