KEGG   Dyadobacter fermentans: Dfer_3798Help
Entry
Dfer_3798         CDS       T00970                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00260  Glycine, serine and threonine metabolism
dfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
dfe01230  Biosynthesis of amino acids
Module
dfe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dfer_3798
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dfer_3798
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dfer_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACT95002
UniProt: C6VWH1
Position
4623179..4623982
Genome map
AA seq 267 aa AA seqDB search
MNRIINLFQNSNTDGSGLLNVYFTAGFPELNDTRRVLQALQDGGADLVEIGMPYSDPVAD
GETIQQSNDRALENGMSVRVLFDQLQGMRETITVPVLLMGYINPVLQYGIEAFCAKCAEV
GVDGLILPDMPMDVYLDEYKSIFDAHGLLNIFLVTPQTSEKRIRQIDEVSEGFIYTVSSA
SVTGSKSGVSGDMQSYFERLDAMNLRNPRLIGFGIKDHDTFVKASSHAAGAIIGSAFIRV
LQESTDLENDIKTFVRDVKRSSEPIPA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattataaatctttttcagaactctaataccgacggcagcgggttactgaac
gtgtatttcacggccggttttcccgagctgaacgatacccggcgcgtgttgcaggcattg
caggatggcggcgcggacctcgtggaaatcggaatgccttattccgatcccgtggccgac
ggcgagacgatccagcaaagcaatgaccgcgcattggagaatggcatgtccgttcgcgtg
cttttcgatcagttgcagggcatgcgcgagacgatcaccgtgccggtgctgctcatgggt
tatatcaacccggtgttgcaatatggcatcgaggcgttttgtgctaaatgcgcggaggtt
ggcgtggacgggctcatcctgcccgatatgccgatggatgtgtatttggatgagtacaaa
tcgatcttcgacgcgcacggcttgctcaatatctttctggtgacgccgcaaacttccgag
aaacgcatccgccagatcgatgaggtgagcgaagggttcatctacactgtttcctcagca
agcgttaccgggtccaagtcgggcgtgagcggggatatgcagtcgtatttcgaaagactc
gatgcgatgaacctccgcaatccgcggctgatcggctttggtatcaaagaccacgacacg
ttcgtgaaggcttcgagccacgccgccggcgcgatcatcggcagcgcgttcatccgcgtg
ttgcaggaaagtaccgaccttgaaaatgacatcaaaactttcgtaagggacgtaaaacgc
tcatccgagccgattccggcctaa

DBGET integrated database retrieval system