KEGG   Dyadobacter fermentans: Dfer_3798Help
Entry
Dfer_3798         CDS       T00970                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dfer_3798
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dfer_3798
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dfer_3798
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dfer_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4623179..4623982
Genome map
AA seq 267 aa AA seqDB search
MNRIINLFQNSNTDGSGLLNVYFTAGFPELNDTRRVLQALQDGGADLVEIGMPYSDPVAD
GETIQQSNDRALENGMSVRVLFDQLQGMRETITVPVLLMGYINPVLQYGIEAFCAKCAEV
GVDGLILPDMPMDVYLDEYKSIFDAHGLLNIFLVTPQTSEKRIRQIDEVSEGFIYTVSSA
SVTGSKSGVSGDMQSYFERLDAMNLRNPRLIGFGIKDHDTFVKASSHAAGAIIGSAFIRV
LQESTDLENDIKTFVRDVKRSSEPIPA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattataaatctttttcagaactctaataccgacggcagcgggttactgaac
gtgtatttcacggccggttttcccgagctgaacgatacccggcgcgtgttgcaggcattg
caggatggcggcgcggacctcgtggaaatcggaatgccttattccgatcccgtggccgac
ggcgagacgatccagcaaagcaatgaccgcgcattggagaatggcatgtccgttcgcgtg
cttttcgatcagttgcagggcatgcgcgagacgatcaccgtgccggtgctgctcatgggt
tatatcaacccggtgttgcaatatggcatcgaggcgttttgtgctaaatgcgcggaggtt
ggcgtggacgggctcatcctgcccgatatgccgatggatgtgtatttggatgagtacaaa
tcgatcttcgacgcgcacggcttgctcaatatctttctggtgacgccgcaaacttccgag
aaacgcatccgccagatcgatgaggtgagcgaagggttcatctacactgtttcctcagca
agcgttaccgggtccaagtcgggcgtgagcggggatatgcagtcgtatttcgaaagactc
gatgcgatgaacctccgcaatccgcggctgatcggctttggtatcaaagaccacgacacg
ttcgtgaaggcttcgagccacgccgccggcgcgatcatcggcagcgcgttcatccgcgtg
ttgcaggaaagtaccgaccttgaaaatgacatcaaaactttcgtaagggacgtaaaacgc
tcatccgagccgattccggcctaa

DBGET integrated database retrieval system