KEGG   Dyadobacter fermentans: Dfer_3798Help
Entry
Dfer_3798         CDS       T00970                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dfer_3798
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dfer_3798
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dfer_3798
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dfer_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4623179..4623982
Genome map
AA seq 267 aa AA seqDB search
MNRIINLFQNSNTDGSGLLNVYFTAGFPELNDTRRVLQALQDGGADLVEIGMPYSDPVAD
GETIQQSNDRALENGMSVRVLFDQLQGMRETITVPVLLMGYINPVLQYGIEAFCAKCAEV
GVDGLILPDMPMDVYLDEYKSIFDAHGLLNIFLVTPQTSEKRIRQIDEVSEGFIYTVSSA
SVTGSKSGVSGDMQSYFERLDAMNLRNPRLIGFGIKDHDTFVKASSHAAGAIIGSAFIRV
LQESTDLENDIKTFVRDVKRSSEPIPA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcattataaatctttttcagaactctaataccgacggcagcgggttactgaac
gtgtatttcacggccggttttcccgagctgaacgatacccggcgcgtgttgcaggcattg
caggatggcggcgcggacctcgtggaaatcggaatgccttattccgatcccgtggccgac
ggcgagacgatccagcaaagcaatgaccgcgcattggagaatggcatgtccgttcgcgtg
cttttcgatcagttgcagggcatgcgcgagacgatcaccgtgccggtgctgctcatgggt
tatatcaacccggtgttgcaatatggcatcgaggcgttttgtgctaaatgcgcggaggtt
ggcgtggacgggctcatcctgcccgatatgccgatggatgtgtatttggatgagtacaaa
tcgatcttcgacgcgcacggcttgctcaatatctttctggtgacgccgcaaacttccgag
aaacgcatccgccagatcgatgaggtgagcgaagggttcatctacactgtttcctcagca
agcgttaccgggtccaagtcgggcgtgagcggggatatgcagtcgtatttcgaaagactc
gatgcgatgaacctccgcaatccgcggctgatcggctttggtatcaaagaccacgacacg
ttcgtgaaggcttcgagccacgccgccggcgcgatcatcggcagcgcgttcatccgcgtg
ttgcaggaaagtaccgaccttgaaaatgacatcaaaactttcgtaagggacgtaaaacgc
tcatccgagccgattccggcctaa

DBGET integrated database retrieval system