KEGG   Dyadobacter fermentans: Dfer_3806Help
Entry
Dfer_3806         CDS       T00970                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dfer_3806
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dfer_3806
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dfer_3806
Enzymes [BR:dfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dfer_3806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4635879..4637186)
Genome map
AA seq 435 aa AA seqDB search
MIFYSTKTADLKASLEEAIFNSLPPDNGLYMPESIPAISKEFMDDIENKSFKEIAIEVTA
TLLGSEITRSEIESIIDRAYDFEAPVVKITPNDYVLELFHGPSMAFKDFGARFMAAIMSY
FLQRSNKEIRILVATSGDTGGAVAQGFYKVPGISVTILYPSGKVSDIQEKQLTTLGHNVT
ALEVEGTFDDCQRLVKEAFLDAELSEKYNLASANSINIARLIPQSFYYFAAYAQLKKLGK
PLVFSVPSGNFGNLSAGVLAYRMGLPVEHFIAATNANNAVPRYLTSGTYEPLPSIETISN
AMDVGSPSNFVRLTRFFNDDWNAINEKVSGAFYNDEQTQKAMREVFGNANYVMCPHTAVA
YRGLQDYRKKTGSDFTGVFLSTAHPAKFIDLVEETLGKSIEVPERLKSLLDIEKVSIKMK
PEFSEFKSLLMNALK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatattctacagtaccaaaactgccgacctgaaagcatccctggaagaagcgattttc
aacagccttcctcccgataacggtctctatatgcccgaatccattcccgcgatttcgaag
gaatttatggatgatattgaaaataaatccttcaaagagatcgccatcgaggtgacggcc
acgcttttgggcagtgaaattacgagaagcgaaattgaatccatcatcgatcgcgcatat
gatttcgaggcgcctgtggtgaagatcacgccgaatgactacgtgctcgaactgtttcat
gggccatctatggctttcaaggacttcggcgcccgttttatggccgcgatcatgtcctat
tttttgcagcgctccaacaaggaaatccgcattctggtagccacgtccggcgacaccggc
ggcgcggttgcacagggtttttacaaagtgccgggcatttccgttaccatcctctaccct
agcgggaaagtaagcgacattcaggaaaaacaactcactaccctcggccacaatgtgacg
gccctggaagtagaagggaccttcgacgactgccagcgcctggtgaaagaggcattcctt
gacgccgaactttccgaaaaatataaccttgcctcggccaactccattaacatagcccgg
ctcattccgcaatcgttctactactttgcggcatatgcgcagctgaaaaaactgggcaag
ccgctagtgttttctgtaccaagcgggaatttcggaaacctcagcgccggcgtactcgcc
tatcgcatgggcttgccggtggaacatttcatcgcggcgacgaatgcaaacaatgcagta
ccgcgttacctcacgtccgggacgtacgaaccgcttccctcgatcgaaacgatttcgaac
gcaatggacgtcggcagcccgagcaacttcgtgcggcttacccggtttttcaatgacgac
tggaatgcgatcaatgaaaaagtttccggcgcattctacaacgacgagcaaacgcagaaa
gcaatgcgggaagttttcggcaatgccaactacgtgatgtgcccgcacacggccgtcgct
taccgcggtcttcaggactaccggaaaaaaaccggcagcgattttaccggcgtgttcctc
tcgacggctcaccccgccaaatttatcgacctcgtggaagaaactttgggaaaaagcatc
gaagtacccgaaagattgaaatcactgctcgatattgaaaaagtgtcgatcaaaatgaaa
cctgaattttcggaattcaaatcattgttaatgaacgccttaaaataa

DBGET integrated database retrieval system