KEGG   Dyadobacter fermentans: Dfer_3827Help
Entry
Dfer_3827         CDS       T00970                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00230  Purine metabolism
dfe01100  Metabolic pathways
Module
dfe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dfer_3827
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dfer_3827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 Thymidylate_kin AAA_25 AAA_19 ResIII cobW AAA_30 MobB CPT AAA RNA_helicase RsgA_GTPase ABC_tran SRPRB TsaE AAA_17 CbiA
Motif
Other DBs
NCBI-ProteinID: ACT95031
UniProt: C6VWK0
Position
complement(4667161..4667730)
Genome map
AA seq 189 aa AA seqDB search
MKGKLIIFSAPSGSGKTTIVRHLLNKYTQQLAFSVSACTRQRRDHEVDGKDYYFLTLQDF
RQKIADQQFAEWEEVYAGNYYGTLKSEIQRLWDEGKHVLFDVDVKGGLKLKEAYGEAALA
VFVKVTSDEEIQRRLSGRGTETPETLATRLAKVRYEQSFEHEFDRVLINDQLDAALAEAE
QLVQEFIQS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggtaagcttatcatattttctgccccttccggatccggaaagaccaccattgta
aggcatcttttaaataaatacacacagcaactggcattttctgtctcggcttgcacgcgc
cagcggcgcgaccacgaggtggatggcaaagattactacttcctgaccttgcaggacttt
cgtcagaaaatagcggatcagcagtttgcggaatgggaggaagtttacgccggcaattat
tacggcacactcaaatcagaaattcagcgcctttgggatgaaggcaaacatgtcctcttc
gatgtggacgtgaagggaggtttaaaactgaaagaagcatatggcgaagccgcactcgcc
gtattcgtaaaagttacctccgatgaagaaatccagcgccggctgtcgggccggggcacc
gaaacacctgaaacgctggccacgcgtttagccaaagtgcgttacgaacaaagtttcgag
cacgaattcgaccgggtgttgatcaatgaccaactggatgcagcgcttgccgaagcggaa
cagctcgtccaggaattcattcaatcctaa

DBGET integrated database retrieval system