KEGG   Dyadobacter fermentans: Dfer_3869Help
Entry
Dfer_3869         CDS       T00970                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_3869 (tpiA)
   01230 Biosynthesis of amino acids
    Dfer_3869 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_3869 (tpiA)
   00051 Fructose and mannose metabolism
    Dfer_3869 (tpiA)
   00562 Inositol phosphate metabolism
    Dfer_3869 (tpiA)
Enzymes [BR:dfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dfer_3869 (tpiA)
Exosome [BR:dfe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dfer_3869 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dfer_3869 (tpiA)
  Exosomal proteins of melanoma cells
   Dfer_3869 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4707125..4707886)
Genome map
AA seq 253 aa AA seqDB search
MRKKIVAGNWKMNKVLDEAVALTSELVNMAKDEVRNDAKIILCPPAIYLTTIKKYIETEP
NFAVAAQNCSDKVSGAFTGEISAQMLQSIGVEYVLIGHSERRQYFNETNALLAEKVNTAL
SFNVSPIFCCGESLEQRQNEDYIGFVKNQITESLFHLSEEQLKSVVIAYEPIWAIGTGLT
ASAEQAQEMHAALRAHIASKYGAEVADEISILYGGSVTAASAPELFAAPDIDGGLVGGAS
LKSREFTNIIKAR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaaaaattgttgccggcaattggaagatgaataaggttctggatgaagcagtt
gcgctcacttccgaactcgtgaacatggccaaagatgaggtccgtaacgatgcaaaaatc
atcctttgcccccctgctatttaccttactaccattaaaaaatatatcgagacggagccc
aacttcgccgtggcagctcaaaattgctcggataaagtttcgggtgcattcaccggtgag
atttctgctcagatgctgcaatcgatcggtgtggaatatgtgctgatcggccacagcgag
cgccgccagtatttcaacgaaacgaatgcattgcttgccgaaaaagtgaatacggcgctt
tctttcaacgtttcgccgattttctgctgcggtgagtcgctcgaacagcgccagaatgaa
gattatatcggatttgtgaaaaaccagatcaccgaaagccttttccacctttcggaagag
caactgaaatcggtggtgatcgcttacgagccgatctgggccatcggtacgggacttacg
gcgtcggctgagcaggcgcaggaaatgcacgcggcattgcgcgcgcacatcgcttcgaaa
tacggtgcggaagtagcggatgaaatttcgatcctttacggcggaagcgttacagccgcc
agtgcacccgagctgtttgcagcaccggatatcgacggcggcctggttggcggcgcttcg
ttgaaatcgagggagtttacaaatattattaaggcgcggtag

DBGET integrated database retrieval system