KEGG   Dyadobacter fermentans: Dfer_3902Help
Entry
Dfer_3902         CDS       T00970                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dfe  Dyadobacter fermentans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dfer_3902
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dfer_3902
Exosome [BR:dfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dfer_3902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4746640..4748139)
Genome map
AA seq 499 aa AA seqDB search
MSKYIAAIDQGTTSTRCILFNQQGNIVSVGQKEHEQIYPQPGWVEHNPTEIWKNTLEVIA
LARINVSAHAQDIAAVGITNQRETTVVWNKRTGKPYYNALVWQDTRTTDLVAKYEREGGL
NQFRDITGLPVSTYFSGLKLKWLLDNVEGIREDAEKGEAIFGNIDTFLIWHLTGGTHGGI
HVTDVTNASRTQLMNLRTLQWDKSMLAAYNIPEIMLPAIKSSSEIYGYSDHEVLPGVPVA
GDLGDQHAALVGQTCFEPGMAKNTYGTGCFLVMNTGTELKTSENGLLTTISYKFGDQPVQ
YALEGSVAVTGALVQWLRDNLGLIQNASDIEALAQTVEDNGGAYFVPAFSGLYAPYWRND
ARGVIAGLTRYVNKGHIARAVLEATAYQTVDVVKAMEQDSGIELASLRVDGGMVHNQLLM
QFQSDILDTQVVSPAVAETTALGAAYAAGLAVGYWKSTDDLKKNWAVAHTWNPNMAEETR
NAYYKGWKKAVTKSYDWID
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatacattgccgccattgaccagggtactaccagcacgcgctgcatacttttc
aaccagcagggaaatatcgtttcggtaggacaaaaagagcacgaacagatttacccgcag
ccgggctgggtagagcacaatcccactgaaatctggaaaaacaccctggaagtgatcgca
ttggcgcggattaatgtgtcggcgcacgcgcaggacatcgccgccgtgggcattaccaac
cagcgcgaaacgacggtggtatggaacaagcgcaccggcaagccttactacaatgcattg
gtgtggcaggacacgcgcaccaccgacctcgtcgcgaaatacgagcgggaaggcggcctc
aaccaattccgcgacattaccggcctccctgtttcaacttactttagtggtttaaaacta
aaatggctgctggacaacgtagagggcatccgcgaagacgctgaaaaaggcgaagcgatt
ttcggaaacatcgatactttcctgatctggcaccttaccggcggcacgcacggcggcatt
cacgtaaccgatgttaccaatgcaagccgcacgcagctgatgaacctgcggacattgcaa
tgggacaaatccatgctggccgcctacaatatccccgaaattatgctgcccgccatcaaa
agcagcagcgaaatatatggttattccgatcacgaggtactgccgggcgtgcccgtcgcc
ggcgacctgggcgaccagcatgcggcattggtaggccaaacctgcttcgaaccgggcatg
gccaaaaacacctacggaaccggctgcttcctcgtgatgaacaccggtaccgaactgaaa
acctctgaaaacggcctgctgacaaccatttcctacaaattcggcgaccagccggtgcaa
tatgcgctggaaggaagtgtggccgtcaccggcgcgctggtgcaatggctgcgcgataac
ctcggcctgatccagaacgccagcgatattgaagccctcgcccaaaccgtcgaagacaat
ggcggcgcctatttcgtaccagcattctcaggcttgtacgcgccctactggcgcaacgac
gcccgcggtgtaatcgcaggccttacgcgctacgtgaacaaagggcacattgcccgggca
gttttggaagccacggcttaccaaacggtggacgtcgtgaaagcaatggaacaagattcc
ggcatcgaactggccagcctacgtgtcgacggcggtatggtgcataaccagctcctaatg
caattccaatcggatattctcgatacccaggtcgtttcaccggccgtagccgaaaccacc
gcgctcggcgccgcctacgctgcgggcctggccgttggctattggaaaagcaccgatgat
ttgaagaaaaactgggccgttgctcacacctggaaccctaatatggccgaggaaacgcgg
aatgcatactacaaaggctggaagaaggctgttaccaagtcgtatgattggattgactaa

DBGET integrated database retrieval system