KEGG   Dyadobacter fermentans: Dfer_3922Help
Entry
Dfer_3922         CDS       T00970                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACT95126
UniProt: C6VXU3
Position
4769440..4770192
Genome map
AA seq 250 aa AA seqDB search
MSRIAFITGATSGIGKATAEAFAGAGIDLILCGRRQDRLDEIAAELAPKVKVTTLIFDVR
DKGAVLAAVGALPDEWKNIDILVNNAGNAHGLGTLDEGDTDDWDAMIDGNVKGLLYVSKA
IIPLLLERGKGHIVNISSIAGKQTYVNGAVYCASKAAVEVISEGMRLELTQHGIRTTNVA
PGAVETEFSLVRFKGDEERADKVYQGFEPLQPGDIADAILYAVNAPDRVTIADITILAGA
QSTATTIHRK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtattgcatttattaccggagctacatccggtatcggtaaggccacggcggaa
gcgttcgccggtgccggaatagaccttattttgtgcggccgccgccaggatcgtctcgac
gagattgcagctgaactcgccccgaaagtgaaagtaacgacgctcattttcgacgttcgc
gacaaaggcgccgtgctcgcggcggtgggtgcgctgcccgacgagtggaaaaacatcgat
attctggtcaacaatgcaggcaatgcccacggcctgggaacactcgacgaaggcgatacc
gacgactgggacgcgatgatcgacgggaatgtgaagggcctactgtatgtttccaaagcc
atcattccgctcctgctcgaacgcggcaagggccatattgtgaacatcagctccattgcc
ggaaagcaaacttatgtgaacggcgccgtgtattgtgcctcgaaggcggctgtggaggtg
atcagcgaaggaatgcgccttgaactgacgcaacacggcattagaactaccaatgtggcg
cccggcgcggtggaaaccgaattctcgctggttcgctttaaaggcgatgaggaacgcgcc
gataaggtgtaccagggcttcgaaccgttacagcccggcgacatcgccgacgcgatcctt
tacgccgtgaatgcgcctgaccgtgttacgattgcagatatcacgatcctcgccggagcg
cagtccaccgccaccaccattcataggaaatag

DBGET integrated database retrieval system