KEGG   Dyadobacter fermentans: Dfer_3930Help
Entry
Dfer_3930         CDS       T00970                                 

Definition
(GenBank) polysaccharide biosynthesis protein
  KO
K03328  
polysaccharide transporter, PST family
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4779922..4781364)
Genome map
AA seq 480 aa AA seqDB search
MENTTPDTFERSVFSGIRWNLIVSFGGQLSNIGFTLLLSRLLGPGDFGLLAAAMALSGLI
ETLGSLGITSALTQRAHLTDRFYSAALLVSCTVAGIMMLTIGFASPLLAAFYGKPQLRDV
FLLIMWSIPLQAIEIFPLAGLQRKLAFDKIAFTSLLSTIAAGITAVWLAYAGYGWLALGV
KLLVAQGVRTASFCFFAWPRFRFQPALAEVRELLRFGLPQSLSQFLLVFGRKIDDILIGK
WMGTGVLGVYSLAYNLYIWPVSNIKGRISQVIFAAFSKIQTDRSAMADYYLKTASLATLI
GFPVIVGFSAVCDLAVPVIMGEKWVDAIPVLRILGLASLFEVSVFPGAIYQAIGHTKAYL
KIIFITRMVTASGIVIALVLDFGLEGVATSIVVTSLIGFFVYNHFVRKIISVTHLALTQV
ITRNGIYSVAMLGVIWAVRYASAGFLPKAAELALSIVVGAGCYWMMMRKYHPEVLALKRL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaacaccactcccgatacgttcgaacgttccgttttctccgggatcaggtggaat
ctcattgtttcttttggaggacagctgagcaacatcgggttcaccctgttgctcagccgc
ctgctggggccgggcgattttggcctgctggctgccgcgatggccctttcggggttgatc
gaaacgctgggttcactgggtatcacctccgccctcacccaacgcgcccacctcaccgac
cgcttctattccgcggcattgctcgtgagctgcacagtggcaggcataatgatgctcacc
attggtttcgcatcgccattgcttgcggcattctacggcaaaccacagctgcgtgacgtt
ttcctgctcattatgtggtcgatacccttgcaggccatcgaaatattcccgctggcaggg
ctgcaaaggaagctcgcattcgacaaaatcgcattcacatcgctgctcagcacgattgcc
gcggggattaccgccgtttggctcgcgtatgcgggttacggatggctggcgctgggcgtg
aagctgctggtagcgcagggtgtccgaacggcctcattctgctttttcgcctggccaagg
tttaggtttcagccggccctggccgaagtccgggaactgctacgtttcggattgccgcaa
tcgctgtctcaattcctgctcgttttcggtcgaaaaatcgatgacattctcattggaaaa
tggatgggcacgggcgtactcggcgtatacagccttgcgtacaacctgtacatctggccg
gtatcaaatatcaaagggcgaatttcacaggtaatcttcgccgcattctcgaaaatccag
accgaccggtcggctatggcggattactatctaaaaacggcatcactggcgacgctgatc
ggctttccggtaatcgtcggcttttcggccgtatgcgacctggctgtaccggtgatcatg
ggagagaagtgggtcgacgcgattcccgtgctgagaatcctcggattagcttcgttgttt
gaggtgtcggtattcccgggcgccatttatcaggcgataggtcacaccaaagcctatttg
aagatcattttcattaccaggatggtaacggcgtctgggattgtaatcgccctcgtcctc
gattttggactggaaggcgtagcgacaagcattgtggtcacaagcctgatcggctttttc
gtgtataatcattttgttagaaagatcatctcggtaacgcatctcgcactaacacaagtc
attacacgaaacggcatttacagcgtcgcgatgctcggtgtgatatgggcagtccggtac
gcctcagccggcttccttcccaaagcagcagaacttgcgttatcaattgtcgttggggcg
gggtgctattggatgatgatgaggaagtaccatcctgaggttctggctcttaaacggctc
taa

DBGET integrated database retrieval system