KEGG   Dyadobacter fermentans: Dfer_3933Help
Entry
Dfer_3933         CDS       T00970                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4783004..4783438
Genome map
AA seq 144 aa AA seqDB search
MTHQSDHRAYFFKIDTTIKKIRNALQKQLTEAGFDLTVDQWVLIDHIFRKQGISQNELAE
MTFKDPPTVTRIIDLLEKKGLVERGPAAGDRRKFNLFLTKNGEAIYNQAFPIVADIRRKG
WGSLSDSDYQHFVRIMDSIYQNFT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcagtcggatcatcgtgcctatttttttaagatagacacgactatcaaaaag
attcggaatgccctccaaaaacagcttaccgaagcggggttcgacctcacggtcgaccaa
tgggtattgatcgatcatattttcagaaaacagggcatcagccagaacgaactggcggaa
atgacattcaaagatcctcccacggtcacaagaatcatcgatttgctcgaaaagaaggga
ttggtagaacgcggccccgccgccggtgaccgccggaagttcaacctttttcttaccaaa
aacggcgaggccatctacaaccaggcatttccgatcgtggccgacatccgccggaaagga
tggggcagcctcagcgactccgattaccagcatttcgtgcggatcatggattctatttac
caaaattttacctga

DBGET integrated database retrieval system