KEGG   Dyadobacter fermentans: Dfer_3936Help
Entry
Dfer_3936         CDS       T00970                                 

Definition
(GenBank) NUDIX hydrolase
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ACT95140
UniProt: C6VXV7
Position
complement(4784944..4785531)
Genome map
AA seq 195 aa AA seqDB search
MANPRVNIASEEVLSNNWYTLRKYTFDYQRADGSWERQAREAYDRGNGAVILLYNAEKQT
VVLTRQFRLPTYTNGNETGMMIEACAGLLDRDNPEECIKRETEEETGYKVSAVKKIFEAY
MSPGSVTEILYFFVAEYSDDMKVGDGGGCATEQENIEVMEIPFREAIDMVASGEINDAKT
IMLIQYAQIHGLVGQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggctaatccgcgtgtaaacattgcttccgaagaagtgctttccaataactggtatacc
cttcgcaaatacacattcgattaccagcgtgccgacggctcctgggagcgccaggcgcgc
gaggcatacgaccgtggaaacggagcggtgatactgctctataatgctgaaaaacagacg
gttgtgcttacgagacaattccggcttcctacctacaccaatggcaacgaaaccggcatg
atgatcgaagcctgcgcggggctgcttgacagggacaatcccgaggaatgcatcaagcgc
gaaacggaggaagaaacaggctacaaagtgagcgcggtgaagaaaattttcgaagcctat
atgtcgcccggttcggtgaccgaaatcctctactttttcgtggccgaatattccgacgac
atgaaggtaggcgacggcggcggctgcgcgaccgagcaggagaacatcgaagtaatggaa
attccgttccgcgaggcaattgacatggtggcgagcggggagattaacgacgccaaaacg
atcatgctcattcaatatgcgcagatccacggcctggtagggcaatag

DBGET integrated database retrieval system