KEGG   Dyadobacter fermentans: Dfer_3961Help
Entry
Dfer_3961         CDS       T00970                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4808447..4809157)
Genome map
AA seq 236 aa AA seqDB search
MNPLAVVTGGTKGIGRAAIEKFLAQGFDVITCARNESDLLALQQTFSESFPQSKLTYLTA
DLSVRADVDAFIAFIHTHNQRPEVLINNTGVFIPGQVHNETEGTLEKTMETNLYSAYHLT
RGLLAGMMERKKGHIFTICSTASIIAYPNGGSYCISKFALYGMTKVLREEMKPYDVRVTA
ILPGATYTDSWKGTDLPEDRFMDSGDVAESIWAAYALSPRAVVEEILIRPQLGDLD
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattagcggttgtaaccggtggaacaaaagggatcggaagggcagcgatagaa
aaatttttagcacaaggcttcgatgtaattacctgcgcaagaaacgagagcgacctgctc
gcactgcaacaaacattcagcgaaagttttccccaatctaaactgacttatttaacggcc
gacctctcggttcgggccgatgtggacgcgttcatcgcatttatccacacccataaccaa
cggccggaagtattgatcaacaacaccggcgtatttatcccggggcaagtccataacgaa
accgaaggcacgctggaaaagacgatggaaacgaacctttatagtgcctatcacctcacg
cgcggcttgctcgcggggatgatggagcgcaaaaagggccatattttcaccatttgctct
actgccagcattatcgcctaccccaacggcggctcctactgcatttcaaaattcgcattg
tacggcatgaccaaggtgctccgcgaggaaatgaagccctacgacgtgcgggtgacggcc
atcctgccgggcgctacctacaccgacagctggaagggcaccgacctccccgaggaccgt
ttcatggattccggcgacgtggccgagtcgatctgggcggcctatgcattgtctcccagg
gcagttgtggaggaaattttgatccgtccgcagttgggagatttggattga

DBGET integrated database retrieval system