KEGG   Dyadobacter fermentans: Dfer_3964Help
Entry
Dfer_3964         CDS       T00970                                 

Definition
(GenBank) polysaccharide biosynthesis protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C Polysacc_synt_3 MatE
Motif
Other DBs
NCBI-ProteinID: ACT95168
UniProt: C6VYW2
Position
complement(4810744..4812246)
Genome map
AA seq 500 aa AA seqDB search
MSVLKKLASETATYGISTMLGRFLNYLLVALHTKLFEPQQIAAQGQLFAYAGLALVLYTF
GMETAFFRFAREEKDRKEYYNVILSAVIVVSMVCSTFMFVFAQPLAELIKYPEATSIVKM
FAIIMATDGIVSIPFARLRLEGKGKKFVVIRVTNILINIFLNLFFLLVCRDIHAGKYLSF
LQPAVDLFYNPLHAPDYIVLANLIANLAFFWMLRKEFADFRFIFNGDLFKPVWVYAFPVM
IMNVGGVLNMLFDRAFIQFLLPEGFYPGRSNETAIGIYVQCYKLSIFMNLAIQAFKYAAE
PFFFSKGEDKNAPPVFAKVTKYFIIICVLMWVGICLNLDLFAELFLKKKIYHEGLSVVPW
LLAGYLFLGVYYNVATWFKLTDKTQYGTWLTLTGAGITISTSFVLVPQIGYHGFAIAFAL
SGFVMLSLCYYFGRKYYPVPYDVTSALGYIGGGALLIYASSLIKIPDLWVSVPVHMGVFA
LCVAVVFLVERKNIPALKRR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtactgaaaaaactggccagtgaaaccgccacctacggcatcagcaccatgctg
ggccgctttttgaattacctgctggtggcgctgcataccaagctttttgaacctcagcaa
atcgccgcacaaggccagctttttgcctatgccgggcttgcgctagtgctctacactttc
gggatggagaccgccttcttccggtttgcacgcgaggaaaaggaccggaaagaatattac
aatgtcatattaagcgctgtgatcgtggtgagcatggtttgctccactttcatgttcgta
tttgcgcagccactcgccgagctcatcaaataccctgaagcgacatccatcgtgaagatg
ttcgcgatcatcatggctacggacggcatcgtgtcgatcccgtttgcgcggctacggctg
gaagggaaagggaaaaagttcgtggtcatccgggtgaccaacattcttatcaacattttc
ctcaatcttttcttcctgcttgtctgccgggatattcatgctggaaaatacctttcattc
ctgcaaccggctgttgatctgttctataacccgctgcacgcgccggattacattgttttg
gctaaccttatcgccaatctcgcgttcttctggatgcttcgcaaagagtttgccgacttc
cggtttatattcaacggcgaccttttcaagccggtgtgggtgtacgcattcccggtcatg
atcatgaatgtgggcggcgtgctcaacatgcttttcgaccgcgcattcatccaatttctg
cttccggagggcttttatcccggccgcagcaacgagaccgccatcgggatttatgtgcaa
tgctataagctgtccattttcatgaacctggccatccaggcatttaaatatgctgccgaa
ccatttttcttttcgaagggtgaggacaagaacgcaccaccggtttttgccaaggttacc
aagtattttatcatcatctgcgtgctcatgtgggtgggcatttgcctcaacctcgacctg
tttgccgagctattcttaaagaagaagatttatcacgaaggattgagcgtagtgccctgg
ctgctggcgggctacctgttcctgggtgtgtattacaatgtagctacgtggtttaaactg
accgacaaaacgcagtacggcacctggctcacactcaccggcgcgggaattaccatctcc
accagcttcgtgctcgtgccgcagatcggctaccacggtttcgccatcgcattcgcattg
tcgggatttgtgatgctgtcgctttgctattatttcgggcggaagtattacccggtgcct
tatgacgtcacttcggcactcggttacattggcggcggcgcattgctgatttacgcctct
tccctcattaaaatacccgatctctgggtttccgtaccggtgcacatgggcgtgttcgcc
ttgtgcgtggccgtggtttttttggtagaacgaaaaaatattccggcactgaaaaggcgg
taa

DBGET integrated database retrieval system