KEGG   Dyadobacter fermentans: Dfer_3966Help
Entry
Dfer_3966         CDS       T00970                                 

Definition
(GenBank) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00061  Fatty acid biosynthesis
dfe01100  Metabolic pathways
dfe01130  Biosynthesis of antibiotics
dfe01212  Fatty acid metabolism
Module
dfe_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dfer_3966
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Dfer_3966
Enzymes [BR:dfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     Dfer_3966
Lipid biosynthesis proteins [BR:dfe01004]
 Fatty acid synthase
  Component type
   Dfer_3966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_1
Motif
Other DBs
NCBI-ProteinID: ACT95170
UniProt: C6VYW4
Position
complement(4813336..4814214)
Genome map
AA seq 292 aa AA seqDB search
MKTAYVFPGQGSQFKGMGLDLYQSSDSAKALFEKANEILGFNITKIMFEGTDEELKQTNV
TQPAIFIHSVILAKINPDFAPNMVAGHSLGEFSALVAAGSLSFEDGLSLVAKRAAAMQKA
CEIRPSTMAAILGLPDAVIEEVCAGITDEIVVPANYNCPGQVVISGTIEGVERANELLKA
AGAKRALVLPVGGAFHSPLMEPAREELAAAIHAAQFEPPICPVYQNVNAKPATEVAVIRE
NLISQLTAPVRWTQSVEQMVADGAEIFIESGPGKVLQGLVKKIASTVDVKSI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggcatatgttttccctggtcagggctcgcagttcaaaggaatgggtctggac
ctctaccagagctccgattccgccaaggcattgtttgaaaaagccaacgaaatcctcggc
ttcaacatcaccaaaatcatgttcgaaggcaccgatgaggagctgaaacaaaccaatgtg
acgcagcccgcaattttcattcattccgtgatcctcgcgaaaatcaatcccgatttcgct
ccgaacatggtggcaggccattcgctcggtgaattttcggcgctggtagccgcaggttcg
ctttcattcgaagacggcctttcgctggtggcgaagcgtgctgccgctatgcaaaaagcc
tgcgaaatccgcccgtcgaccatggctgccatcctcggcctgcccgatgcggtgatcgaa
gaagtttgcgcgggtattaccgacgagatcgtagtgccggcaaactacaactgtccgggc
caggtggtgatttccggcacgatcgaaggtgtggaacgcgccaacgaactgctgaaagcc
gccggggctaaacgtgcgctggtgttgccggtgggcggtgcattccactcgccattgatg
gagccggcacgcgaagagctggcagcggccatccatgcggcgcagttcgagccgccgatc
tgccccgtttatcagaatgtgaatgcaaagccggccaccgaagtagccgtgatccgggaa
aacctgatctcgcagctcaccgctccggtaaggtggacgcagtccgtggagcaaatggta
gccgacggcgcggaaatcttcatcgaatcgggaccgggcaaagttttgcaaggccttgta
aaaaagatcgctagcacggtggacgtaaaaagtatttaa

DBGET integrated database retrieval system