KEGG   Dyadobacter fermentans: Dfer_3968Help
Entry
Dfer_3968         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHU_C FlgD_ig
Motif
Other DBs
NCBI-ProteinID: ACT95172
UniProt: C6VYW6
Position
complement(4817473..4820379)
Genome map
AA seq 968 aa AA seqDB search
MIRPLSARILLVILMLTLAFSQAFATHFRAGEITARRMSLTSHIYEIKVTGYFDMVSGKD
AADRQTSVFFKIGNVQSTGTPVTIEAPRIMPIVDIGNNTTMNTYIATYTFPTTGAYRISM
EVDARNDGVLNIGPEPTNRLNFYVSTVLEINATFGLNRTPVLRNAPIDLAAVGQRYIHNP
GAFDADGDSIAYRMFTPQQAGANGVGVNLEYQDPNTVTPPGQTETGGSPATFAINRVTGD
IIWNAPVTKGYYNVAFVVEEWRDGALIGQIVRDMQIIVDDVRNDRPAVPPLPDICVEAGT
LINQRVTATDRNGDRLNLTSASGVYDPTLIKPAVASFTVSGQGSQSSVTGTFVWQTSCEH
IRLEPYNVLFKVEDAAPPGYPNPSLFRKLADMTTWNIRVYGPKPTGLKGVAATDPAGTAY
RLTWDAYKCQIAGAKIAIYRAEQCTDIPDDVCSPGIPAGSGYQEIGRVDVDETTFLDNNN
GDGLRPGVSYSYRIVVLFPRPGASPGEPGYLIGGGESIASPEFCLNLPVVMPVITNVTVD
STSTTKGVITVKWMRPAAAAGLPAQYRLFRATGQNGTAFTQIATINTNLAAGARDTLFVD
RNLDTEANAYNYKLEYYTTVNGQLTKFDETKTASSVRLEQDAAQPNQIGLKWSALVPWSN
NNRVHRIYREDKARPGTFNRIAEVSVQGPQTFSFVDDGTDQYAADGVVNVSIAKDSTYCY
KVETVGSYNNSQIKPAVLYNFSQILCISPSDTIKPCPPVLSLDPLNCDSLQNIPQAFCNT
IGFTNHLTWQYPQQAGGRDCDPLVTAYRVYYARYEGDTPTLITTITTPPSPLQTAYDHEG
LTSFAGCYYVTAVNKFGTESAPSNTVCRDNCPMYVLPNVFTPNGDAKNDIFQPYECPAFV
QSLEFKAFNRWGAEVFSTRDVNINWDGKTNGGKELAAGQYYYELTIYFESSKKQGTETSM
KGWVQLLR
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgatcagacctctatctgcccgcatcctgcttgtaattctcatgctgacgcttgcgttc
agccaggcatttgcgacccacttccgggccggcgaaatcactgcgcgcaggatgtcgctc
acatcgcacatctacgagatcaaagtcaccggctattttgacatggtcagtggaaaagac
gctgcggaccggcagacatcggtcttcttcaaaatagggaatgtgcagtctacgggcacg
ccggtaaccatcgaggcgccgagaataatgccgattgtggacatcgggaataacaccacc
atgaatacctacatcgccacctacaccttcccgaccaccggcgcctaccgtatttccatg
gaagtggatgcaagaaacgatggcgtactgaatattggcccagagcctaccaaccggctt
aacttctatgtcagcacggtgctcgagatcaatgccacatttggtttgaaccgcactccc
gttctccgaaacgctccgatcgacctcgccgcggtgggccagcgctatattcataaccct
ggcgcattcgacgccgatggcgacagcattgcttaccgcatgttcactccccagcaagcc
ggcgccaacggagtaggcgtgaacctggaataccaggaccccaacaccgtgacacctccc
ggccaaaccgaaacgggcggctcgccggccacttttgccattaaccgggttacgggcgac
atcatctggaatgcaccggtaacaaaaggatattataacgtcgcgtttgtcgtggaagaa
tggcgcgacggggcactgatcgggcagatcgtccgagatatgcagatcatcgtcgacgat
gtgcgaaacgaccggcccgcggttccgcccttaccggacatttgcgtggaagccggcacg
cttatcaaccaaagagtgaccgccaccgacagaaacggcgacaggctcaacctgacttcg
gcgagcggtgtttatgatccgacactgatcaaaccggccgtggccagtttcaccgtatcc
gggcagggttcgcagagctcggttaccggcacgttcgtttggcaaacttcctgcgagcat
atcagactggaaccatacaatgtgctcttcaaagtcgaggacgcggcgcctccgggctat
ccgaacccttcgctgttcaggaaactggccgacatgacgacctggaatatccgtgtgtac
ggtcccaaacctaccggcctgaaaggcgttgccgccaccgacccggccggcaccgcttac
cggctcacatgggatgcctacaaatgccagattgccggcgcgaaaatcgccatttatcgt
gccgagcaatgcaccgatattccggacgatgtgtgcagccctggcattccggcgggctcc
ggctaccaggaaattggcagggtggacgtggatgagactacattcctcgacaataacaat
ggcgacggcctgcgcccgggcgtttcctattcttaccgcattgtggtgctgtttccgaga
cccggcgcctctcccggcgaaccggggtatctgattggcggcggcgaaagcatcgcctca
ccggagttttgcctcaatttacccgttgtgatgcccgtcattaccaatgtgacggtcgat
tccaccagcactaccaaaggtgtgatcacggttaaatggatgaggccggccgctgccgcg
ggacttccggcgcaataccggcttttcagggctacgggacagaatggcacggcgtttaca
caaattgcaaccattaatacaaacctcgcggcaggcgcgcgcgacacactgttcgtggac
cgaaacctcgacaccgaagccaacgcctacaattacaaactcgaatattacaccaccgta
aacgggcagctaacgaagtttgacgaaacgaaaacggccagctctgtaaggctcgaacaa
gatgcggcgcagcccaatcagatcgggctgaaatggagcgcgttggtgccgtggagcaac
aataaccgcgttcatcggatttaccgcgaggacaaagcccggcccggcacgttcaaccgc
attgcggaagtatcagtgcagggaccgcaaacgttcagtttcgtggatgacggcaccgac
cagtatgctgccgatggcgtcgtgaatgtgagtattgccaaagactctacctattgctac
aaagtggagacggtgggctcttacaataacagtcagatcaaaccggccgtattgtataat
ttttctcaaatcctttgcatttcaccatcggatacgattaagccctgtccgccggtgctg
agcctcgatccgctcaattgcgactcgcttcaaaacattccgcaggcgttctgcaacacc
atcggattcaccaaccacctcacgtggcaatatccccagcaagccggcggccgtgactgc
gacccgctcgtgaccgcctaccgcgtgtactatgcaagatatgagggcgacacgccaacg
ctcatcacgaccatcactaccccgccgtcgccgctgcaaacggcttatgaccacgaggga
ctgacgtcttttgccgggtgttattatgtgacggccgtcaacaaattcgggaccgagagt
gcgccgagcaacaccgtttgcagggacaattgcccgatgtatgttttgcccaatgtattc
acaccgaacggcgatgccaaaaacgacattttccaaccttatgaatgcccggcatttgta
caatccctggaattcaaggcattcaaccgctggggtgcggaggtgttttcgaccagggac
gtgaatatcaattgggacggtaaaacgaacggggggaaagagcttgcggccggccaatac
tactacgagctgacgatctattttgaatcatccaaaaaacagggcaccgagacgagcatg
aaaggctgggtacagttgctgaggtag

DBGET integrated database retrieval system