KEGG   Dyadobacter fermentans: Dfer_3969Help
Entry
Dfer_3969         CDS       T00970                                 

Definition
(GenBank) succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family
  KO
K00241  
succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3969
   00650 Butanoate metabolism
    Dfer_3969
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4820670..4821341
Genome map
AA seq 223 aa AA seqDB search
MSWFSQTLTSSIGKKLLMALTGLFLISFLVIHATINAMIFYNDGGETFSHWGHFMGTNPI
IRTLEIGLVAGFIIHIADGLILWKNNREARPVGYAVSNASANSTWYSRSMGLLGTLLLIF
LVIHTSHFWIPNRSNQFATGEELDLYQMMLDIFQNPIVVLIYVLGCVSLFWHLLHGFKSA
FQSLGLNHVKYNGIISWIGTAFSIVIPILFALMPISIYLGWVK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggttttcacaaacgttaacgagctctatcgggaaaaaacttttgatggctctt
accggactttttctgattagctttctggtgattcatgccaccatcaatgccatgattttt
tacaatgatggcggggagactttttcgcattgggggcacttcatgggtaccaacccgatt
atacgtacgcttgaaatcggcctcgttgcgggcttcatcatccatatcgccgacggtctg
atcctctggaaaaacaaccgtgaggcacgtccggtaggttacgcggtcagcaatgcatcg
gccaacagcacctggtactcgcgcagcatgggcttgctcggaactttgcttttgatcttc
ctggtgatccacacttcgcacttctggattcctaaccggtccaaccagtttgccacaggc
gaggagctggacttgtaccagatgatgctcgatatcttccagaacccgatcgtggtgttg
atttatgtgttgggctgcgtgtcgcttttctggcatttgctgcacggtttcaaaagcgca
ttccagtcgctgggcctcaaccacgtgaagtacaatggcatcatctcgtggattggaact
gcattctcgattgtcattccgatcctcttcgcgctgatgccgatctcgatttatctgggc
tgggtgaagtaa

DBGET integrated database retrieval system