KEGG   Dyadobacter fermentans: Dfer_3970Help
Entry
Dfer_3970         CDS       T00970                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  
succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3970
   00650 Butanoate metabolism
    Dfer_3970
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3970
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dfer_3970
    1.3.5.4  fumarate reductase (quinol)
     Dfer_3970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4821388..4823376
Genome map
AA seq 662 aa AA seqDB search
MATSSRLDAKIPQGTLESKWSKYRSSVPLVNPANKRNLEIIVVGTGLAGASAAATLAELG
YKVKAFCFQDSPRRAHSIAAQGGINAAKNYQNDGDSVYRLFYDTIKGGDYRAREANVHRL
AEVSGNIIDQCVAAGVPFAREYGGLLSNRSFGGTQVQRTFYAAGQTGQQLLLGAYSGLQR
QVGMGTVKMYNRHEMLDVVNIDGKCRGIIARNLITGEIERHAGHAVLLCTGGYGNVFYLS
TNAMGSNVTAAWKAHKRGAFFGNPCFTQIHPTCIPVSGEHQSKLTLMSESLRNDGRIWVP
KKQNDTRPGNEIPENERDYYLERRYPAFGNLVPRDIASRAAKERCDAGYGVGTSKLAVYL
DFAAAVERYGRAEANKNNIHNASEADIITWGKAVVKEKYGNLFDMYKQITGEDPYEVPMR
IYPAVHYTMGGLWVDYNLMTTVPGLYSLGEANFSDHGANRLGASALMQGLADGYFVIPYT
IGAYLASEIRTGKISTDHEAFVKAEAEVKERIDTLLRIQGKTSPELFHRRLGKIMWEKCG
MARNAEGLKEAIQEIRQLRRDFWSDVKVMGTANYFNPELDKANRVADFIELGELMCIDAL
DRNESCGGHFREEYQTEEGEALRDDENYMYVSAWEHKGPENWELHKEELVYENIKIAQRS
YK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtcatctcgtctggatgccaaaataccgcaaggaacgcttgaaagtaaatgg
agcaaataccgctcgtcagtacctcttgtaaaccctgccaacaaacgtaacctggaaatc
atcgtggttggaacaggcctcgcaggtgcttcggcggctgctaccctggctgagctcggt
tacaaagtaaaagcgttctgttttcaggattcgccacgtcgtgcgcactcgatcgcagcg
caaggcgggatcaatgcagcaaaaaactaccagaatgacggtgactcggtttaccgtctt
ttttatgataccattaaaggcggtgactaccgggcgcgtgaagcgaacgtgcaccgcctg
gccgaagtttcgggtaacattatcgaccaatgcgtagcggcgggtgtgcctttcgcccgt
gagtacggcggcttgctgtccaaccgctctttcggtggaacgcaggtacagcgtaccttc
tacgcagcgggccagacgggccagcaacttttgctgggagcctattccggcttgcagcgc
caggtgggtatgggtaccgtaaaaatgtacaaccgccacgaaatgctcgacgtcgtgaat
atcgatggcaaatgccgcggtatcatcgcacgtaacctcattacaggcgagatcgaaaga
catgcaggccacgccgtattgctttgtacaggtggttacggaaacgtgttctacctttcc
acgaatgcaatgggcagcaatgtgaccgcggcatggaaagcccacaaacgcggtgcattc
ttcggtaacccttgttttacccaaatccacccgacttgtatccccgtttccggcgaacat
cagtcgaaactgaccctgatgtcggaatcgttgcgtaacgacggccgtatctgggttccc
aaaaagcagaatgatacccgcccgggcaacgaaattcctgaaaacgagcgcgattactac
cttgaacgccgttaccctgcattcggtaacctcgtaccgcgcgatatcgcgtcgcgggcg
gcgaaagaacgttgcgatgccggttacggtgtaggaacttccaagctggccgtttacctc
gatttcgctgcggcggtagagcgttacggacgtgccgaggcgaataagaacaatattcac
aatgcgtccgaagccgacattatcacgtggggtaaggccgttgtgaaagaaaaatatggt
aacctcttcgatatgtataagcaaatcacgggtgaagatccgtatgaagtgcctatgcgt
atctatcctgcggtgcactacaccatgggcggcctttgggtggattacaacctgatgacc
accgtgcccggcttgtactcgcttggtgaggccaacttctccgaccacggcgccaaccgc
ctcggtgcttcggcattgatgcagggccttgccgacggttatttcgtgattccgtacacc
atcggtgcttacctggcgagcgaaatccgtaccggaaagatctctaccgaccacgaagca
ttcgtgaaagcggaagccgaagtgaaagagcgtatcgacacattgctgcgcattcagggt
aaaacatctcctgagcttttccaccgccgtttgggcaagattatgtgggaaaaatgcgga
atggcgcgtaatgcggaaggtttgaaagaagcgatccaggaaatccgtcagctgagaaga
gacttctggtcggacgtgaaagtaatgggaaccgccaactacttcaaccccgaactcgac
aaggcaaaccgcgttgcagacttcatcgaacttggcgagctgatgtgtatcgacgcgctg
gaccgtaacgaatcctgcggtggccactttcgcgaggagtaccagaccgaagaaggcgaa
gcattgcgcgacgacgagaactatatgtatgtatcggcctgggagcacaaaggtcctgag
aactgggagcttcacaaggaagagctggtgtacgaaaacatcaaaatcgctcagcgcagc
tataaataa

DBGET integrated database retrieval system