KEGG   Dyadobacter fermentans: Dfer_3971Help
Entry
Dfer_3971         CDS       T00970                                 

Definition
succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Orthology
K00240  
succinate dehydrogenase iron-sulfur subunit [EC:1.3.99.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dfe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:dfe00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:dfe00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:dfe00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4823452..4824204
Genome map
AA seq 250 aa AA seqDB search
MRLSLKVWRQSNKDAAGGFEEYKLDHVSPDMSFLEMFDVLNEQLIEEGKEPVSFDHDCRE
GICGACSMYINGRPHGPLRGVTTCQLHMRSFNDGDTIVVEPWRAQAFPVIKDLVVDRDAF
DRVISAGGFVSVNTGNAQDANALPIAKEAADDAFAAAACIGCGACVAACKNASAMLFVSA
KISQLALLPQGQAERSIRAEKMVAQMDAEGFGACTNTGACSAECPKEISLENIARMNREY
IGAKFSSSAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtctctcaaagtttggagacaaagcaataaagacgcagcgggaggtttcgag
gaatacaaactggaccatgtttctcccgatatgtcatttcttgaaatgttcgatgtattg
aacgagcaactcatcgaggaaggaaaagaacctgtatcattcgaccacgactgccgcgag
ggtatttgcggggcttgttcgatgtatataaatggccgtccgcatggaccgttgcgcggg
gtaaccacctgccaactgcacatgcgttcgttcaacgacggggatactatcgtggtagag
ccatggagagcgcaggctttcccggtgatcaaagacctcgtggtagaccgtgacgcattc
gaccgcgtgatttctgcgggcggtttcgtatcggtgaacaccggtaatgcacaggatgca
aacgcattgccgatcgcgaaagaagctgctgacgacgcatttgcagcagcagcatgtatc
ggttgcggcgcttgcgtagcggcttgtaaaaatgcttccgcaatgcttttcgtatctgcc
aaaatctcccagctggcattgttgccgcaaggacaggcagaacgcagcatccgcgccgag
aaaatggtcgctcaaatggacgcagaaggcttcggagcctgcaccaacaccggtgcctgc
tcagcagaatgccctaaggaaattagcctcgaaaacatcgcccgcatgaaccgcgagtac
atcggcgcgaaattctcgtcttcggcggtttaa

DBGET integrated database retrieval system