KEGG   Dyadobacter fermentans: Dfer_3971Help
Entry
Dfer_3971         CDS       T00970                                 

Definition
succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Orthology
K00240  
succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_3971
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3971
   00650 Butanoate metabolism
    Dfer_3971
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3971
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dfer_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4823452..4824204
Genome map
AA seq 250 aa AA seqDB search
MRLSLKVWRQSNKDAAGGFEEYKLDHVSPDMSFLEMFDVLNEQLIEEGKEPVSFDHDCRE
GICGACSMYINGRPHGPLRGVTTCQLHMRSFNDGDTIVVEPWRAQAFPVIKDLVVDRDAF
DRVISAGGFVSVNTGNAQDANALPIAKEAADDAFAAAACIGCGACVAACKNASAMLFVSA
KISQLALLPQGQAERSIRAEKMVAQMDAEGFGACTNTGACSAECPKEISLENIARMNREY
IGAKFSSSAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtctctcaaagtttggagacaaagcaataaagacgcagcgggaggtttcgag
gaatacaaactggaccatgtttctcccgatatgtcatttcttgaaatgttcgatgtattg
aacgagcaactcatcgaggaaggaaaagaacctgtatcattcgaccacgactgccgcgag
ggtatttgcggggcttgttcgatgtatataaatggccgtccgcatggaccgttgcgcggg
gtaaccacctgccaactgcacatgcgttcgttcaacgacggggatactatcgtggtagag
ccatggagagcgcaggctttcccggtgatcaaagacctcgtggtagaccgtgacgcattc
gaccgcgtgatttctgcgggcggtttcgtatcggtgaacaccggtaatgcacaggatgca
aacgcattgccgatcgcgaaagaagctgctgacgacgcatttgcagcagcagcatgtatc
ggttgcggcgcttgcgtagcggcttgtaaaaatgcttccgcaatgcttttcgtatctgcc
aaaatctcccagctggcattgttgccgcaaggacaggcagaacgcagcatccgcgccgag
aaaatggtcgctcaaatggacgcagaaggcttcggagcctgcaccaacaccggtgcctgc
tcagcagaatgccctaaggaaattagcctcgaaaacatcgcccgcatgaaccgcgagtac
atcggcgcgaaattctcgtcttcggcggtttaa

DBGET integrated database retrieval system