KEGG   Dyadobacter fermentans: Dfer_3971Help
Entry
Dfer_3971         CDS       T00970                                 

Definition
succinate dehydrogenase/fumarate reductase iron-sulfur subunit
Orthology
K00240  
succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1]
Organism
dfe  Dyadobacter fermentans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dfer_3971
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dfer_3971
   00650 Butanoate metabolism
    Dfer_3971
  Energy metabolism
   00190 Oxidative phosphorylation
    Dfer_3971
Enzymes [BR:dfe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dfer_3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4823452..4824204
Genome map
AA seq 250 aa AA seqDB search
MRLSLKVWRQSNKDAAGGFEEYKLDHVSPDMSFLEMFDVLNEQLIEEGKEPVSFDHDCRE
GICGACSMYINGRPHGPLRGVTTCQLHMRSFNDGDTIVVEPWRAQAFPVIKDLVVDRDAF
DRVISAGGFVSVNTGNAQDANALPIAKEAADDAFAAAACIGCGACVAACKNASAMLFVSA
KISQLALLPQGQAERSIRAEKMVAQMDAEGFGACTNTGACSAECPKEISLENIARMNREY
IGAKFSSSAV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgtctctcaaagtttggagacaaagcaataaagacgcagcgggaggtttcgag
gaatacaaactggaccatgtttctcccgatatgtcatttcttgaaatgttcgatgtattg
aacgagcaactcatcgaggaaggaaaagaacctgtatcattcgaccacgactgccgcgag
ggtatttgcggggcttgttcgatgtatataaatggccgtccgcatggaccgttgcgcggg
gtaaccacctgccaactgcacatgcgttcgttcaacgacggggatactatcgtggtagag
ccatggagagcgcaggctttcccggtgatcaaagacctcgtggtagaccgtgacgcattc
gaccgcgtgatttctgcgggcggtttcgtatcggtgaacaccggtaatgcacaggatgca
aacgcattgccgatcgcgaaagaagctgctgacgacgcatttgcagcagcagcatgtatc
ggttgcggcgcttgcgtagcggcttgtaaaaatgcttccgcaatgcttttcgtatctgcc
aaaatctcccagctggcattgttgccgcaaggacaggcagaacgcagcatccgcgccgag
aaaatggtcgctcaaatggacgcagaaggcttcggagcctgcaccaacaccggtgcctgc
tcagcagaatgccctaaggaaattagcctcgaaaacatcgcccgcatgaaccgcgagtac
atcggcgcgaaattctcgtcttcggcggtttaa

DBGET integrated database retrieval system