KEGG   Dyadobacter fermentans: Dfer_3974Help
Entry
Dfer_3974         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT95178
UniProt: C6VYX2
Position
complement(4825749..4826114)
Genome map
AA seq 121 aa AA seqDB search
MNFLIIAILSAVLQIFTPWWVIAIVPFVVLAWRPVTFRGAFWAGFGGIAVPWLLYGYYQH
FISDGALSDRVAKIFMLPNGIVLLLVTAIVGGLVGGFSGLAGYWVRQIFRRSSVPAAGTA
P
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctgatcatagccattctgtcggccgtgttgcaaatattcaccccctggtgg
gtcattgccattgttccgttcgtggtgctcgcctggcgcccggtaacgttccgaggggca
ttctgggcgggttttggcggtattgccgtgccatggctgctttacggctattatcagcat
ttcatttccgacggtgccctgtccgaccgtgtcgcgaagatattcatgttgccgaacggg
atagtgcttctgctggtcacggcgatcgtgggcgggctggtaggcggcttttcgggcctg
gcgggatattgggtgcggcaaatcttccgccggagttccgtcccagctgccgggacggct
ccctga

DBGET integrated database retrieval system