KEGG   Dyadobacter fermentans: Dfer_3983Help
Entry
Dfer_3983         CDS       T00970                                 

Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00270  Cysteine and methionine metabolism
dfe00450  Selenocompound metabolism
dfe00920  Sulfur metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01130  Biosynthesis of antibiotics
dfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dfer_3983
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dfer_3983
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dfer_3983
Enzymes [BR:dfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Dfer_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 Met_gamma_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACT95187
UniProt: C6VYY1
Position
complement(4832248..4833393)
Genome map
AA seq 381 aa AA seqDB search
MNFATKAIHAGVEPDPATGAIMTPIYQTSTYVQESPGKHKGYEYGRSSNPTRTALQTALA
ALENGKHGLCYASGLAATDAVLKLFRPGDEIIAPSDIYGGTYRLMKRIFEPLGLVFRFID
LEEVPAIAQLISAKTRMVWLETPTNPLLKIIDIEQVTRICKERNVLTCVDNTFASPYLQN
PLDLGADMVMHSVTKYLGGHSDTVMGALVTSNDELAAQLKFIQNASGAVPGPQDCFLVLR
GLKTLHIRMQRHCENAAQVAVWLSAHPKVGKVYYPGLPAHPGHELAARQMRGFGGVVSFE
LKDDSYQTAVRTMENLQIFALGESLGGVESLCTHPASMSHGGMPREERLKIGLKDTLIRL
SVGIEDVEDLIADLDQAIGTD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgcaaccaaagccatccacgcgggcgtcgagccggaccctgctaccggcgcc
attatgacgcccatttaccaaacctccacctacgtgcaggaaagccccggcaagcacaaa
ggctatgagtacggccgcagcagcaacccgacgcgcaccgcattgcaaaccgctttggcg
gcgttggaaaacggcaaacacggcctttgctacgcttccggcctggcggccaccgacgct
gtgctgaaacttttccggcccggcgacgaaatcatcgcccctagcgacatttacggtggc
acctaccgccttatgaaacgcattttcgagccgctgggattggtttttcgatttattgac
ctggaagaagtgcccgctatcgctcagctgatttcagcaaaaacgcgaatggtgtggctc
gaaacgcctaccaatccactgctgaaaatcattgatatcgagcaggtaacccgcatttgc
aaggaacggaacgtgcttacctgcgtggacaatacttttgcatcgccctatctgcaaaac
ccgctcgacctcggcgccgatatggtgatgcattcggttaccaaataccttggcggccat
tccgacacggtaatgggcgcgctggtcaccagcaacgacgagctggcggcgcaattgaag
ttcattcagaacgccagcggcgcggtaccggggccgcaggactgctttctggtattgagg
ggattaaaaacgctgcacatcagaatgcagcgccattgcgaaaatgccgcgcaggtggcg
gtgtggctttcagcacatcccaaagtcggcaaagtgtattaccccggcttgcccgctcat
cccggccacgagctggcggcacggcaaatgcgcgggtttggcggcgtcgtatcatttgaa
ttgaaagatgacagttatcaaacggccgtgcggacgatggaaaacctgcaaatattcgca
ttgggcgagtcgctgggcggtgtcgaatcgctgtgcacgcatcctgcaagcatgtcgcac
ggcggaatgccgcgggaagagcggctgaaaataggcttgaaagacacattgatccggctt
agcgtgggaattgaggatgtagaagatctcatcgccgaccttgatcaggcgatcggcacc
gattag

DBGET integrated database retrieval system