KEGG   Dyadobacter fermentans: Dfer_3983Help
Entry
Dfer_3983         CDS       T00970                                 

Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  
cystathionine gamma-synthase [EC:2.5.1.48]
Organism
dfe  Dyadobacter fermentans
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dfer_3983
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dfer_3983
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dfer_3983
Enzymes [BR:dfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Dfer_3983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4832248..4833393)
Genome map
AA seq 381 aa AA seqDB search
MNFATKAIHAGVEPDPATGAIMTPIYQTSTYVQESPGKHKGYEYGRSSNPTRTALQTALA
ALENGKHGLCYASGLAATDAVLKLFRPGDEIIAPSDIYGGTYRLMKRIFEPLGLVFRFID
LEEVPAIAQLISAKTRMVWLETPTNPLLKIIDIEQVTRICKERNVLTCVDNTFASPYLQN
PLDLGADMVMHSVTKYLGGHSDTVMGALVTSNDELAAQLKFIQNASGAVPGPQDCFLVLR
GLKTLHIRMQRHCENAAQVAVWLSAHPKVGKVYYPGLPAHPGHELAARQMRGFGGVVSFE
LKDDSYQTAVRTMENLQIFALGESLGGVESLCTHPASMSHGGMPREERLKIGLKDTLIRL
SVGIEDVEDLIADLDQAIGTD
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgcaaccaaagccatccacgcgggcgtcgagccggaccctgctaccggcgcc
attatgacgcccatttaccaaacctccacctacgtgcaggaaagccccggcaagcacaaa
ggctatgagtacggccgcagcagcaacccgacgcgcaccgcattgcaaaccgctttggcg
gcgttggaaaacggcaaacacggcctttgctacgcttccggcctggcggccaccgacgct
gtgctgaaacttttccggcccggcgacgaaatcatcgcccctagcgacatttacggtggc
acctaccgccttatgaaacgcattttcgagccgctgggattggtttttcgatttattgac
ctggaagaagtgcccgctatcgctcagctgatttcagcaaaaacgcgaatggtgtggctc
gaaacgcctaccaatccactgctgaaaatcattgatatcgagcaggtaacccgcatttgc
aaggaacggaacgtgcttacctgcgtggacaatacttttgcatcgccctatctgcaaaac
ccgctcgacctcggcgccgatatggtgatgcattcggttaccaaataccttggcggccat
tccgacacggtaatgggcgcgctggtcaccagcaacgacgagctggcggcgcaattgaag
ttcattcagaacgccagcggcgcggtaccggggccgcaggactgctttctggtattgagg
ggattaaaaacgctgcacatcagaatgcagcgccattgcgaaaatgccgcgcaggtggcg
gtgtggctttcagcacatcccaaagtcggcaaagtgtattaccccggcttgcccgctcat
cccggccacgagctggcggcacggcaaatgcgcgggtttggcggcgtcgtatcatttgaa
ttgaaagatgacagttatcaaacggccgtgcggacgatggaaaacctgcaaatattcgca
ttgggcgagtcgctgggcggtgtcgaatcgctgtgcacgcatcctgcaagcatgtcgcac
ggcggaatgccgcgggaagagcggctgaaaataggcttgaaagacacattgatccggctt
agcgtgggaattgaggatgtagaagatctcatcgccgaccttgatcaggcgatcggcacc
gattag

DBGET integrated database retrieval system