KEGG   Dyadobacter fermentans: Dfer_3987Help
Entry
Dfer_3987         CDS       T00970                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Blt1_C Sigma70_r2
Motif
Other DBs
NCBI-ProteinID: ACT95191
UniProt: C6VYY5
Position
4836966..4837289
Genome map
AA seq 107 aa AA seqDB search
MTFPNQQILDRVTQGDEAAFTQLRSYFHVPAFKFCSVLLKDETEAEHVIDSVFNKIWNDR
LDLRAEGNFQSYLFSSLKDQIFGEMKRYADPVARKQYFDRIQSLGVS
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgactttccctaatcaacaaattttggatcgggtaacccagggtgacgaggcggcattt
acgcaactacgttcgtatttccacgtcccggcattcaaattttgctccgttctgttgaag
gacgagacggaggcggagcatgtcatcgattccgtttttaacaagatctggaatgaccgt
cttgacctgcgggcggagggaaactttcaatcgtacctgttcagcagcctcaaagaccag
attttcggcgaaatgaaaaggtatgccgaccccgtggcccgaaagcagtatttcgatcgg
atccagtcgcttggcgtcagttaa

DBGET integrated database retrieval system