KEGG   Dyadobacter fermentans: Dfer_4010Help
Entry
Dfer_4010         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA_2 DUF3971 AsmA
Motif
Other DBs
NCBI-ProteinID: ACT95214
UniProt: C6VZ08
Position
4860074..4862572
Genome map
AA seq 832 aa AA seqDB search
MFQKVLKVIGIVALVCFFLFGAVELWIYKNREKLFRNAQELINENLNGNLEIGDFKFRPF
YGALGLNFTLYDVKLTDTLYNVHHHPFLKAEKIHVALDLKHVFTGDIRIKNLVLEDGGLR
LFTQKDGYSNLSIFKSGKEKKDSKKGDNDGMVKKLGNVRFANFAVAYSDSVKRKYFGAIF
RDATNIIERTDSSTNATLTGSVYFDGLTFNADKGGFLMKQETTLALVLGYDEDEKQLKIY
PSILESATHDKIGINGVFDFSDTIKVFHLNFEAKGIAVKDALPLLNKRLKTQIDSIGVQA
NVDTQVKVAGILGRPGLKPQVDVHFETDTFRYNLPVGVLRNMKASGTFTNRADTTKLADV
FNSRLIAPKITGFFETIPFAFKLVVNNFRNPRADIDGRIEADSTNMGALLDPARYRFKHG
SARIDFHFSGNLKRFYNAEKDNFDGKVSGKVMLKNIAMDYLPQKVRISKINGDLTFNEKV
MVLPNLRFYDGQNTLFVRGTLLDLIPYLFGSPKPLRANVDINIPDWQLNWLETLLAARGT
SKPKSQNSLKLSNLLDNAIDQMEITAKLDAKKLKYRHFTGRDVKGEFTISNNAVSIEYFQ
LKAFGGGRVRLSGEMDNDGAGKLPHMSVRAKIENADVHSVFYSFDNFGQKALTHENLKGI
LNTEFNFESALNNNVRLVPSSMKGLLRIDLTNAYIINFEPFMKMKKLIFKRRNFERVRFA
PIRNDFRLNGQEIAIAPMEIESNVLTLYIDGIYSFGNKTDINIQIPLSNLKKRDSTYVLD
PNNPEKRQGSKIFLRAVDENGEVNIKLAFRRKKKDKSDDDDSEVKKLEDVER
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagaaagttctcaaagtcattggtattgttgccctggtttgctttttccttttt
ggggctgtggagctctggatttataaaaaccgggaaaagctgttccggaatgcgcaggag
ctgatcaatgagaatctcaatggcaatctcgaaatcggggacttcaaattcaggcctttt
tacggcgcgctcggtctcaacttcacgctgtacgacgttaaattgactgacacgctctac
aacgttcatcaccatccgtttcttaaagccgagaaaattcacgtcgccctcgacctgaaa
catgtttttacaggtgatatacgcattaaaaacctggtactcgaagacggcggcctgcgg
ttgttcacgcagaaggacggctattcgaacctgtctattttcaaatcgggcaaggaaaag
aaggacagtaaaaagggagataatgacggaatggtcaaaaagctgggcaatgtccggttt
gcgaacttcgccgtcgcctattccgactccgtgaaacggaaatacttcggcgccattttc
cgcgatgccaccaacattatcgaacggaccgattcgagcacgaatgcgaccttgaccggg
tcggtgtactttgatggattgactttcaatgccgacaaaggcggttttctcatgaagcag
gagacaacactcgccctggtgctcggctacgacgaggatgaaaagcaattgaaaatatac
ccgtccattctcgaaagcgctacgcatgacaagatcgggattaacggcgtgttcgatttc
tcggataccatcaaagtctttcatctcaatttcgaggccaaaggcattgccgtaaaagac
gcattgccgctgctgaataagcggttaaaaacacaaatcgattccattggcgtgcaggcc
aatgtggatacgcaggtaaaagtggcaggaatactcggccggccggggcttaaaccgcag
gttgacgtgcattttgaaacggatactttcagatataaccttccggttggagttttgaga
aacatgaaagcctcgggcaccttcaccaaccgcgccgacacgaccaagctggccgacgtt
ttcaactcccgcctcattgcacccaagattaccggcttttttgaaaccattccatttgca
tttaagctggtggtaaacaacttccgcaacccgcgtgcagatatcgacggtcgcattgaa
gccgactctaccaacatgggcgcgttgctcgatcccgcacgttaccgtttcaaacacggg
tcggcgcgcatcgacttccatttcagcggcaacctgaaacgcttctacaacgcggaaaag
gataatttcgatggaaaagtgtctgggaaggtgatgcttaaaaatattgccatggattac
ctgccgcagaaagtgcggatcagcaaaatcaatggggaccttacatttaacgaaaaagtg
atggtgctgcccaacctgcgtttttacgacgggcaaaacacgcttttcgtgaggggaacg
ctgctcgacctgattccttatcttttcggctcgcccaagccgctgcgcgccaatgtggat
atcaacattcccgattggcagctcaactggctcgaaaccctgctcgccgcccgcggtacc
agcaagccgaaatcgcaaaattcactcaaactgtcgaacctgctggacaatgcgatcgac
cagatggagattaccgcgaagctggacgcgaagaagttgaaataccggcatttcaccggt
cgcgacgtgaagggagagttcacgatcagcaacaatgccgtgagcatcgaatattttcag
ctcaaagcattcgggggcgggcgcgtgaggctttcgggtgaaatggataatgacggcgcg
gggaaattaccgcatatgtcggtgcgggccaaaatagagaatgccgacgtgcattcggtg
ttttactctttcgacaattttggacaaaaagccctcacgcacgaaaacctgaaaggcatc
ctgaatacggaattcaatttcgaatcggcgctgaacaacaatgtacggctcgtgccgtcg
agcatgaaaggattgttgcggatcgatctgacgaacgcctacattatcaacttcgagccg
ttcatgaaaatgaaaaagctaattttcaaacggcgcaacttcgagcgcgtcagattcgcg
ccgatccggaacgatttcaggcttaacggccaggagatcgccatcgcgcccatggaaata
gagtccaatgtgctcacgctctacatcgacggcatttacagtttcgggaacaaaaccgat
attaacattcaaattccgctcagtaacctcaaaaaacgcgattcaacttacgtcctcgat
ccaaacaacccggaaaaacggcagggctccaagattttcctccgggctgtcgatgaaaat
ggcgaggtgaatatcaaactggccttccgacgcaagaagaaggacaaatcggacgatgac
gattccgaagtcaaaaagttggaagacgtggagcggtga

DBGET integrated database retrieval system