KEGG   Dyadobacter fermentans: Dfer_4013Help
Entry
Dfer_4013         CDS       T00970                                 

Definition
(GenBank) protein of unknown function UPF0118
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4864230..4865399
Genome map
AA seq 389 aa AA seqDB search
MYLKLASTLVALIATVYILYILRETLIPLAFSILLAILLHPVCAWLELRRVPRIGAILLS
ILALFTAIVILVYLVSMQVGSFAEELPRITEKAEAILDQTLTLGERYLNISRTQQVSEAQ
KYLINALSEGRAFLLNTLVTTTGAISTFVLIPLYIFFFLLYRDFFRMFVHKAIRRVPNEE
LNVLLKKIYEVIQSYLSGLFLVILIVGVLNSIGLLILGIPHAIFFGFLAGFLILIPYIGI
LIGSVLPALLSIVTMDSPWYAVGVIGVMSFVQFLEGNFITPNIVGSKVSVNPLAAIVALF
LGGQLWGLSGLILALPVTAILKVILDTVPSLEPYGFLLGEPVHEVAEEKADIARGQVAEK
EFRKKPYRRHRNKPKKRPEGDAPPAPPAI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgtacctgaaactcgccagcacgctggtggcgctcattgcgacggtgtacattctttat
atcctccgggaaacgcttattccgctcgcattctcgattttactcgctatcctgctccat
cccgtgtgcgcgtggctcgaactgcgcagagtgccgcgcataggcgccattttgctgagc
attctggcattgttcacggcgatcgtcattctcgtttacctcgtgtcaatgcaggtaggc
agttttgcggaagagcttccgcggattaccgaaaaagcggaggcgatcctggaccagacg
ctcacactcggagagcgctatctcaatatcagccgtacgcaacaggtgagcgaggcgcaa
aaatacctgatcaatgcattaagcgaaggccgcgcatttttgctcaatacgcttgtcacc
accaccggcgcgatttctacgtttgtcctgataccgctttacatattctttttcctgctc
taccgcgattttttcagaatgtttgtccacaaagcgatccgccgcgtgccgaatgaagag
ttgaatgtgctgttgaaaaaaatctacgaagtaattcaaagctacctgtcaggcctgttc
ctcgtcatactgatcgtaggcgtgctgaacagcatcggattgctgatattgggcatcccg
catgcgatatttttcggtttcctggccggtttcctgatcctgatcccctacatcggcatc
ctgattggttcggtgctgcccgcattgttaagcattgttaccatggattcgccgtggtat
gccgtgggggtgatcggtgtgatgagcttcgtgcagtttctggaaggtaattttattacg
ccaaacatcgtgggttccaaggtgagcgtcaacccgctggctgctatcgtcgcattgttt
ctcggcgggcagctttggggcctttcgggtctgatcctcgcattgcccgtaaccgccatt
ctgaaagtgattttggatactgttcccagcctcgaaccgtatggtttcctgctcggagag
cccgttcacgaggtagcggaggaaaaagccgacatagcccggggccaggttgctgagaag
gaattcaggaagaaaccctatcgccggcaccgcaataagcccaaaaagcggcccgaaggt
gatgcaccgccggctccgcctgccatttag

DBGET integrated database retrieval system