KEGG   Dyadobacter fermentans: Dfer_4016Help
Entry
Dfer_4016         CDS       T00970                                 

Definition
(GenBank) protein of unknown function DUF224 cysteine-rich region domain protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4866533..4867330)
Genome map
AA seq 265 aa AA seqDB search
MSDTAYRVPTMAEMTANNETPEVLFWVGCAGAFDDRYKKVTVAFVKILNSAGVKFAVLGT
EESCTGDPARRAGNEFTFQMLAMSNIQVLDMYNVKKIVTACPHCFNTLKNEYPALGGNYE
VLHHSEYLQQLIDAGRVRLEGGEAFKGKKITFHDSCYLGRANNVYEAPRQVLEALDADLV
EMKRCRTKGLCCGAGGGQMFKEPEPGKKDVNIERIEEALQTGADTIAVACPFCMVMMTDG
VKNKEKEQSVKVYDLAELIAQAKGL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgcataccgcgtgcccacaatggccgagatgacggcgaataacgaaacg
ccggaagtgttgttctgggtgggttgcgccggggcattcgacgaccgctataagaaggtt
accgtagcattcgtgaagattttgaacagcgcaggcgtgaagttcgccgtgctcgggacg
gaagaaagctgcacgggcgacccggcacgaagggcaggaaatgagttcacgttccagatg
ctggctatgtccaatattcaggtgctggatatgtacaatgtcaagaaaatagttaccgca
tgcccgcattgttttaacacgcttaaaaacgagtatcctgcattgggcggcaattacgag
gttttgcaccattcggaatacctgcaacagctgatagacgcgggccgcgtgcgcctggaa
ggcggtgaggcgttcaaagggaaaaaaatcacgttccacgattcgtgttacctcggccgc
gccaacaatgtgtatgaagccccgcggcaggttttggaagcgctcgatgccgatctggtc
gagatgaagcgctgccggacgaagggcctgtgctgcggcgcaggaggcggacagatgttc
aaagaacccgaaccagggaaaaaggacgtgaatatcgagcggatcgaggaagcattgcag
accggcgccgatacgatcgccgtcgcttgtccgttttgtatggtaatgatgaccgacggg
gttaaaaacaaggaaaaagagcagtccgtaaaagtgtacgatctggccgagctcatcgcg
caggccaaaggtttgtaa

DBGET integrated database retrieval system