KEGG   Dyadobacter fermentans: Dfer_4017Help
Entry
Dfer_4017         CDS       T00970                                 

Definition
(GenBank) oxidoreductase, Fe-S subunit
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_9 Fer4_8 Fer4_10 Fer4_17 Fer4_16 Fer4_7 Fer4_2 Fer4 Fer4_4 Fer4_22 Fer4_21 Fer4_18 Fer4_6 Fer4_3 Nitrate_red_gam
Motif
Other DBs
NCBI-ProteinID: ACT95221
UniProt: C6VZ15
Position
complement(4867342..4868685)
Genome map
AA seq 447 aa AA seqDB search
MAILQQVIFIAALGAVAWLIYQRVGIIGKTIRLGKDEDRTDQPSKRLSIMMRVAFGQKKM
FDRPLIGVLHFAVYAGFILINVEILEIVLDGIFGTHRLFAGALGGFYGVLIGFFEFLALS
VLIACALFLVRRSVLKVERFQPARHREMNGWPQLDGKLILVFEIVLMIAILTMNAADSAL
QDLGSAHYPQTGDFLISQFIKPLFTGWSEPALIAYERTAWWIHILGIFAFAVYLTYSKHL
HIVLAFPNTYFSRLEPKGEMKNMPEITSEVKMMLGLETQAGDAVVPERFGAKDVPDLSWK
NLMDAYSCTECGRCTAACPANMTGKKLSPRKIMMDTRDRLEDIGRNMLANKGEFVPDNKS
LLGDYILEEEILACTTCNACVQECPVLINPLDIILQLRRHKVMDEAQAPGSWNMMFQNLD
TNQAPWKFSPSDRFNWAAGLESKSIDS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcttacagcaagtcatctttatagccgccctcggagcggtggcctggctgatt
taccagcgggttggcattatcggcaagaccatccggcttgggaaggacgaagaccgcact
gatcagccttccaagcggctttcgatcatgatgcgcgtcgcgttcgggcagaagaagatg
ttcgacaggccgcttattggtgtgctgcattttgccgtttatgccggatttatcctcatt
aatgtcgaaatcctggaaattgttctggacggaatctttggcacacaccggctttttgcg
ggcgcgttgggtggcttttatggcgtgctcattggtttcttcgagtttctcgcgttgagt
gtccttattgcctgcgccttattccttgtccgtcgcagtgtcctgaaagtggagcgtttt
cagccggcgaggcatcgtgaaatgaatggctggccgcagctcgatggcaagctgatcctg
gtttttgaaattgtgctgatgatcgccattctgacgatgaatgctgccgacagcgcattg
caggacctcggcagtgcccattatccgcaaaccggcgattttctgatcagccaatttatc
aagccgctttttacaggttggagcgagccagcgctcattgcctatgagcgaacggcttgg
tggatccacattctcggcattttcgcattcgccgtctatctcacctactcgaagcatttg
cacattgtcctagcgtttccaaacacgtatttctcgcggttggagcccaaaggtgagatg
aagaatatgcccgagattacctctgaggtaaaaatgatgctcggacttgaaacccaggct
ggcgatgccgtggttcccgagcgcttcggggccaaagatgtgcccgatttgagctggaaa
aacctcatggacgcctattcctgcaccgaatgcgggcgctgcacggcagcctgcccggcc
aacatgaccggcaaaaagctctcgccccgcaagattatgatggatacgcgcgatcgcctc
gaagacatcggtcgcaatatgctggccaacaagggcgagtttgtgcccgataacaaaagt
ctgctgggcgattatatcctcgaagaagaaatcctcgcctgcaccacgtgcaatgcctgc
gtgcaggaatgccccgtgctcatcaatccgctcgacattatcctccaattgcgcaggcac
aaggtcatggacgaggcgcaggcgcccggctcgtggaacatgatgtttcagaacctcgat
accaatcaggcaccctggaagttctcgcccagcgaccgtttcaactgggccgcgggattg
gaaagtaaatcaatagattcataa

DBGET integrated database retrieval system