KEGG   Dyadobacter fermentans: Dfer_4019Help
Entry
Dfer_4019         CDS       T00970                                 

Definition
(GenBank) polysaccharide biosynthesis protein
  KO
K03328  polysaccharide transporter, PST family
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_3 Polysacc_synt Polysacc_synt_C
Motif
Other DBs
NCBI-ProteinID: ACT95223
UniProt: C6VZ17
Position
complement(4870243..4871694)
Genome map
AA seq 483 aa AA seqDB search
MGLKKDLFSGVAVTAIAKYSGILIGLVINAMLARLLSPKEYGIVGVVIVFITFFNILSDI
GLGSAIVQNQNLSQKDHSDLFKLSAIMSSVLAIAFALFSYAVAFFYKNDVYIPIGQLLAI
HVFFSSLSVVPKNLLIKSQLFKKIAIIEVCTALTAGLIAVLLASQHYSYFAIVWRSIFMS
SVTFVLYFLMSGVKFQKGLSLAPARRVAKYSSFQFGFNFINYFSRNLDNILIGKFMGNVQ
LGVYNQAYQLMMYPIANLTFVITPVLHPILAKYQHDKAFIYKEYVNVVNILAVLGIPISV
FVFFSSEEIVQVMLGSKWSAVVPVLKVLSLSVWIQMILSSSGSIFQASGRTDLLFLSGAL
SAVFTIGAILAGIFYYQSMQATAWLLVSAFAFNFFQGFYTLIVHALKESPRIFIKAILSK
APMALAMVVTLLAKNRCVEMMHIDLPLIPSILINIVICLVFFILFQHALVSTLVKKFVPQ
RAT
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggcttaaaaaaggatcttttttcgggggtggcggtaaccgccatcgccaagtattcc
gggattctcatcggattggttatcaatgccatgctcgcgcgccttctcagcccgaaagaa
tacgggatagtgggtgtggtgatcgtttttattacgttttttaacattctcagcgacatt
ggtctaggctcggcgatcgtgcagaaccaaaacctctctcaaaaagatcactctgatctt
ttcaaactaagcgcgatcatgagcagcgtccttgcgattgcattcgcgctgttctcttat
gctgtcgcgtttttttacaaaaatgacgtctacatcccgatcggacagctgctggccatt
catgtctttttcagttcgctcagcgtagttcctaaaaatttactcatcaagtcacagctg
ttcaaaaagatagccattatcgaagtttgcactgctctcaccgccgggcttattgctgtg
ctgctggcttcgcagcattacagctatttcgccattgtgtggagatcaatatttatgagc
tcggtcacgtttgtcctttacttcctgatgtccggcgtaaaattccagaaggggctatcg
ctcgctcccgcgcgccgggttgcgaaatattcttcgttccaatttggattcaattttatc
aattacttctcaaggaaccttgacaacatcctcatcggcaaattcatgggtaacgtccag
ctgggcgtgtataaccaggcgtaccagttgatgatgtacccgatcgccaatctgaccttc
gtgatcactccggtgctgcatcctatccttgcgaaatatcagcacgacaaggcctttatc
tacaaggaatatgtcaatgtggtcaatatcctcgccgtcctgggcataccgatatccgtg
ttcgtatttttttcttccgaagaaattgtccaggtcatgctgggaagcaaatggtcggcg
gttgtacctgtactgaaagtattgagtctatccgtctggattcaaatgatcctttccagc
agcggctccatattccaggcgtctggaaggaccgatctgctgtttttatcgggcgcatta
tcagcagtgttcaccatcggagcgattctggcagggattttttactaccaatccatgcag
gcaaccgcctggctgctggtgagcgcatttgcatttaatttcttccagggtttttacacc
ctcattgttcacgcactgaaagaatctcctcgcatttttatcaaagcaattctctccaaa
gcgcccatggcgctggcgatggtggttacgctactcgcaaaaaaccggtgcgtcgaaatg
atgcatattgaccttcctctcattccatcaatcctcatcaacatcgtgatctgccttgtg
tttttcatcctgtttcaacatgcccttgtctcaacactcgtgaaaaagtttgtgccgcag
agggccacttaa

DBGET integrated database retrieval system