KEGG   Dyadobacter fermentans: Dfer_4020Help
Entry
Dfer_4020         CDS       T00970                                 

Definition
(GenBank) glycosyl transferase group 1
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4871698..4872804)
Genome map
AA seq 368 aa AA seqDB search
MKLNVVVYGVVAGSYRTQNLIRSLFDISEINLFYLNPGLLWERPSLWNKIQRMIVELTVV
WRSDIIIIPATRHQNPYKYKLAKFFKKQIITDFYISYYDTFVTDRKTIAKESPEAAKHFK
LDRNAILSSDRTIFLNGSEAEYYTRLLDIKLSDIRYSIVPLCVDARQKAANPFANGTTDK
LTICWWGSYIPLHGLDKIIEAAHLLSKIMSDFEFVLFGNDDEKAMPFRNKIRELGIENFV
KIDNSKSFHNGQLEPFLVSRCDIALGGFGDSEKAKNVFLNKVADAFAFGIPVLSMKTKAM
DTLLSGDDIVICDNQPQAIVDAVTALKMDRERLKKIGENGYNRYLDTFSYEAFKSRVKGV
IQPQLNGN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaacgtagtggtctacggagttgtggctggaagttacagaacacaaaacctg
atcagatccctttttgacatttccgagataaatctgttttatctcaatcccggacttcta
tgggaacggccctccctctggaacaaaatccagcggatgatcgtagaactgaccgtcgtg
tggcgatcggacatcattattattccggcgacgaggcatcaaaacccctacaaatacaag
ctggcgaagttcttcaaaaaacagataattactgatttctacatttcctactacgatacc
tttgtcaccgatcgcaagacgatagccaaagaaagccccgaagccgccaagcatttcaag
ctggatcggaatgctattctctcatccgaccgcaccatttttctcaatgggtccgaagca
gaatattacacaaggctgctcgacataaaactatcggatatccgatacagcatcgttccg
ctttgcgtggatgcccgccaaaaggccgcaaacccattcgcgaacggcactacggataag
ctgaccatctgctggtggggctcctatattccgctgcacgggctggataaaatcattgaa
gccgcgcatttgctttccaaaatcatgtcggacttcgagtttgtgctatttgggaacgat
gatgagaaagcgatgccttttcgaaataagatcagggaattagggatagagaattttgtg
aaaatcgataattcgaaatccttccacaacggacagctggaacctttccttgtgtcgcgc
tgcgacattgccctgggcggtttcggcgatagtgaaaaagcaaaaaacgtatttctgaat
aaggttgccgacgcgttcgcgttcggaatccccgttttgagtatgaaaaccaaagctatg
gatacgctgctttcgggggacgacatcgtgatctgcgataatcaaccgcaagccattgtc
gacgcagttacagcactaaaaatggacagggaaagattaaagaagataggagaaaacgga
tacaatcgatatctcgatacattctcctacgaggcctttaaatcgcgggttaaaggggta
atccaacctcaactcaacggtaactag

DBGET integrated database retrieval system