KEGG   Dyadobacter fermentans: Dfer_4021Help
Entry
Dfer_4021         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4873307..4873891)
Genome map
AA seq 194 aa AA seqDB search
MISTTVKYKLYPSLLSCFDRFERGYLDEQGLLDRINRVPVPQTEAQFRGASFEDAVIKGI
GEESFDPEILSKVRSFLPRPMLKTQVYCEYQLNDSLIYGYVDVIGKMLAVDIKTTGNYRT
GCFAQSHQNFYLPALRAKGIRSLRYVITDFKDVYLEEYDQMVDLNYQEGQVLRFCEFLEA
QRERVTDLRVFARI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaccaccgtaaagtacaaactatatccatcgttactaagctgcttcgaccgt
ttcgagcgcggctacctggacgaacaggggctgctcgaccgcatcaaccgcgttccggtg
ccgcaaaccgaagcccagttccgaggagcgtcgttcgaagatgcggtgatcaaaggcatc
ggtgaagaatcattcgacccggaaatactatccaaagtgcggtcattcctcccgcgcccc
atgctgaaaacgcaggtttactgtgaatatcaactgaatgacagccttatttacggttat
gtggatgtaatcgggaaaatgctggcagtcgacattaaaacgaccggaaactaccgcacg
ggctgttttgcccaaagccatcaaaacttttacctgcccgcactccgggcgaaagggatc
agaagtctacgctatgtgatcacggatttcaaggacgtttatcttgaagaatatgatcaa
atggtagatttgaattatcaggaggggcaggttttgcggttttgtgaatttctggaagcg
caacgcgaacgtgtaacggatctgcgcgtattcgcgcgtatctga

DBGET integrated database retrieval system