KEGG   Dyadobacter fermentans: Dfer_4026Help
Entry
Dfer_4026         CDS       T00970                                 

Definition
(GenBank) transposase IS204/IS1001/IS1096/IS1165 family protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4877108..4877953
Genome map
AA seq 281 aa AA seqDB search
MYPENTGPYLSIDETSLSNGELYTIVTNKATKGRKGSLVAMVKGTQASSVIEVLRKIPKR
IRGKVREVTLDMAANMGLIVSRCFPKASKVIDRFHVQKLAFDAVQEIRIQHRWRALDQEN
QAIEEARQSGLAYQPEILSNGDTLKQLLVRSRYLLFKHHEKWTFSQVQRSRLLFERYPLI
EQAYKLATGLGTVFRVCKSKEQAFKKLALWYNQVEDCGLDSFKTVARSIQTHYLDILNCF
NNRSTNASAESFNAKIKAFRSSSRGVRDIQFFLFRLTKLYA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccctgagaacaccggtccgtatttaagcattgacgagacctctctttccaacgga
gagctttacactattgtgaccaataaagcaaccaaggggcgaaaaggctcattggtggct
atggtcaaaggcacgcaagccagctctgtcatcgaggttttgagaaagattcccaagcgc
atccgcggcaaagtacgggaagtgacgctggacatggccgccaacatggggttgatagtc
agtcgatgctttccgaaggcgtcaaaggttattgatcgtttccatgtccagaaactagcc
tttgatgcagtacaagaaattaggatacaacatcggtggcgggctttggatcaagaaaat
caagctattgaagaggccagacaatccggtttggcatatcagcccgagattctttctaat
ggcgatactcttaaacagctgctagtcaggagcaggtacttgcttttcaagcatcatgaa
aaatggaccttctcacaggtccagcgttcccggctactttttgaacgttacccacttatc
gagcaggcttacaagctcgcaacaggcttaggaaccgtttttcgggtttgcaagtccaaa
gagcaggcatttaaaaagctggcgctctggtacaatcaggtagaagattgcggcctggat
tctttcaaaactgtggccaggtccattcaaacgcattatctggacatcctaaactgcttc
aataacaggagcaccaacgcttcagctgaatcattcaatgcgaagatcaaggcttttagg
tcatcttccagaggcgtgagggatattcaattcttcctattcaggcttaccaaactctat
gcttaa

DBGET integrated database retrieval system