KEGG   Dyadobacter fermentans: Dfer_4027Help
Entry
Dfer_4027         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4878023..4878385
Genome map
AA seq 120 aa AA seqDB search
MESFLPIIPFLLPEFILENFELTSIDRQDGVFHVHIDEKNADENDPERKNLLSKGFFPTI
TVQDFPIRGHKVFLHIKRRRWLNTKTGKVVYRDWTEVGNGTRMTSEFANFLKDISRYQPE
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
ttggagagtttcctgcctattattccgtttctactaccagagttcatcctcgaaaatttt
gaattaacctccatcgaccggcaggacggtgtatttcatgtgcatatcgacgagaagaat
gcagatgagaatgacccggaaaggaagaacctgctctccaagggcttttttccgacaatt
actgttcaggatttcccaattcggggccataaggtctttcttcacatcaagcgtcgcagg
tggctcaataccaaaacaggaaaagtagtttacagagactggactgaggtaggtaatgga
acgcgaatgacgagtgaattcgcgaattttttaaaagatatcagtcgataccagcccgaa
tag

DBGET integrated database retrieval system