KEGG   Dyadobacter fermentans: Dfer_4029Help
Entry
Dfer_4029         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT95232
UniProt: C6VZ26
Position
4879358..4879633
Genome map
AA seq 91 aa AA seqDB search
MLNPSYSTSFGLDPASARAASAYKQGVGDGPPLRFESLNSHESTEKSVLFLFLILPKFSR
CDGSPLPIESSVSGSARKVGELQMKLLFLSK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatccaagttactccacaagttttggtcttgatccagcatctgcccgcgcggcg
tccgcttacaagcagggggtcggggacggtccgccgctgcggttcgaatccctcaactcc
cacgaaagcaccgagaaatcggtgctttttttgtttttaatccttcccaagttcagccgc
tgcgacggttcgccgctgccgatcgaatcctcagtttccggatcagcccgaaaagttggc
gagcttcaaatgaagttgttgtttctttcgaagtaa

DBGET integrated database retrieval system