KEGG   Dyadobacter fermentans: Dfer_4030Help
Entry
Dfer_4030         CDS       T00970                                 

Definition
(GenBank) Ankyrin
  KO
K06867  
uncharacterized protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4879728..4880393
Genome map
AA seq 221 aa AA seqDB search
MKTILLLLLAGMFASCNANDQPVTNEMNMRQDNLIELVTKNDLEGMKKALAAGANVNTRD
NRGRTLLLLATIDKQTAMATLLAENGADANLQDDIHDSPFLYAGATGQTELVKIFLARGA
RFDIFNRYNGTALIPACERGHVETVKVLVGTKGFPVNHVNRLGWTALMEAIVLGNGSKKY
QEIVQILKDGGADVGIPDHDGVTPLQHARNRGFAEIVKILE
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatattgctgcttctgctggcgggtatgtttgcatcttgtaatgcgaatgat
cagccggtcacaaacgagatgaatatgcgacaggacaacttaatcgagctggtaacaaaa
aacgacctcgaaggcatgaagaaggcgctcgctgccggagctaatgtaaatacaagggac
aatcgtggacgtacgctcctgttgttggcgactatcgacaaacaaacggcgatggccacg
ctgctcgccgagaatggcgctgatgccaatttgcaggatgatattcacgacagcccgttc
ctttacgcaggggctaccgggcaaacggagctggtgaaaattttcctggctcgtggcgcg
cggtttgacattttcaaccggtacaatggaaccgcattgatccccgcatgcgaacgcgga
cacgtggaaaccgtgaaagtgctggtcggcacgaaaggcttcccggttaatcatgtgaat
cggctcggctggaccgcattaatggaagcgatagtgttgggaaacggaagtaaaaagtat
caggaaatcgtgcagatcctcaaagatgggggtgccgatgttggaattcccgaccacgac
ggtgtcacaccgttgcagcacgccagaaatcgcggttttgctgagattgtgaagattttg
gaatga

DBGET integrated database retrieval system