KEGG   Dyadobacter fermentans: Dfer_4032Help
Entry
Dfer_4032         CDS       T00970                                 

Definition
(GenBank) oxidoreductase domain protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C CCDC53
Motif
Other DBs
NCBI-ProteinID: ACT95235
UniProt: C6VZ29
Position
complement(4881705..4882862)
Genome map
AA seq 385 aa AA seqDB search
MKKQINVGIVGYKFMGRAHSNAWIKAPLFFDTPSTPVLKAACGRHQESLSEFAQNWGWEE
TEPDWQKLVTRPDIDIIDIALPQNLHYEVALAAAKAGKHIFCEKPLSMTSEQAAEMLKVC
QETGVKHYLNHNYRRVPAVALAKKMIEEGKIGRIFHWRCAYQQDWIVDPSFPLTWQLKKE
TAQAGPQWDLNSHAVDLAHFLIGDVTSVSALTTNFIKERPIADETATGSLSGASKGDEMG
EVTVEDAALMMVRFENGAIGSFEATRFATGRKNRLTFEIYGSKGSLVFDLERMNELQYYS
NEDTKGEHGFRTILATESIHPYAGNWWPAGHIIGYEHAFVHAVVDFLNAIENDTDIKPDF
ADGLKIIQVLEAGLRSAELGGEVRL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagatcaatgttggcatagtcggttacaaattcatgggtcgcgcgcacagt
aatgcgtggatcaaggcgccgttgtttttcgatacgccttcaacgccggtcctcaaagca
gcctgcggccgccatcaggaatccctctcggagtttgcccaaaactggggctgggaagaa
accgaacctgattggcaaaaactcgtgacccggcccgacatcgatatcatcgacatcgca
ttgcctcagaaccttcattacgaagttgccctggccgcggcgaaagcaggcaagcatatt
ttctgcgaaaaaccactttccatgaccagcgagcaggccgccgaaatgctgaaagtgtgc
caggaaacgggcgtgaagcactatctcaaccataactaccgccgcgtcccggctgtcgcg
cttgccaaaaagatgatcgaagagggcaaaatcggccggattttccactggcgctgtgcc
tatcagcaggattggatcgttgacccgtcatttccgctcacctggcaattgaaaaaggaa
actgcgcaggccgggccgcaatgggacctcaactcgcacgcggtcgacctggcccatttt
cttatcggcgacgttacgtccgtgtccgcactcaccacgaatttcatcaaagagcgcccc
atcgccgatgaaaccgccaccggcagcctctccggcgcatccaagggcgacgaaatgggt
gaagtaaccgtcgaagacgcggcattaatgatggtaaggttcgaaaacggcgctatcggc
tcgttcgaagcgacgcgctttgcgacaggccgcaaaaatcgcctcacattcgaaatctac
ggcagcaagggtagtctcgttttcgacctcgaacgaatgaacgagctgcaatactattcc
aacgaagacaccaaaggcgaacacggcttccggacgatcctcgcgacggaatccattcac
ccgtacgccggcaactggtggcccgccgggcacataatcggctacgaacacgcgttcgta
cacgcagtggttgactttctgaatgccattgaaaacgatacggacatcaaaccggacttt
gcggatggattaaagattattcaggtgctggaagcggggctgcgctcggcggagcttggt
ggcgaggtgcggttgtag

DBGET integrated database retrieval system