KEGG   Dyadobacter fermentans: Dfer_4037Help
Entry
Dfer_4037         CDS       T00970                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4 Fer4_21 Fer4_8 Fer4_16 Fer4_17 Fer4_10 Fer4_9 Fer4_2 Fer4_22 Fer4_18 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ACT95240
UniProt: C6VZ34
Position
4889023..4890564
Genome map
AA seq 513 aa AA seqDB search
MSEYFKNISDGISTTLTGMRLTLRHLWNARKSRKPADIRSSSFYDQQDGIVTIQYPQETI
PIPDNGRYRLHNEMDDCIVCDKCAKVCPVDCIDIEPIKAVEDVGRASDGSPIRLYAAKFD
IDMAKCCYCGLCTTVCPTECLTMTKTFDYSELDVRDMVYNYSNLTTEQADEKRMLLEQFQ
KEKEALKAAKAATPAAAASAGAAPATTAPARPVFKPTAKPKPAEEPASETASQEPAAPTP
KPAFKPVMKPKKAEENTPAVDPAPTEKPTAGKPVFRPTLKPKVVSEENAEKPVAETPAEP
AEKPVAAKPPFRPTMKPKAASEENAEKPVAETPAEPAEKPVAAKPPFRPTMKPKAVSEEN
AEKTVSETPAEPAEKPVAAKPPFRPTMKPKVVADDNAEKPVAEAPAKPAEKPVAAKTPFR
LTMKPKAVLEENAEKPVEEAPAEPIERPVAAKPAFRPTMKPKVVAENNAEKPVAEVPAEP
AEKPVAEAPAEPAEKPAAAKPAFRPTMKPKPKE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagaatactttaaaaatatatccgacggcatcagtacgaccctcacgggcatgcgg
ctgacgttacggcacctctggaatgcgcgcaaaagccgtaagcctgcggatatccgttca
tccagcttttacgaccagcaggatgggatcgtcaccatccaatacccccaggaaaccatt
cccattccagacaatggcaggtaccgtttgcacaatgaaatggacgactgcattgtttgc
gacaaatgtgcgaaggtttgtcccgtggattgtattgacattgagcctattaaagccgta
gaggacgttggtcgcgcctccgacggttcgccgatccgtttgtatgcggcgaagttcgat
atcgacatggccaaatgctgttattgcggtctttgcaccacggtttgtccgacggaatgc
cttacgatgacgaaaactttcgattacagcgagctggatgtgcgggatatggtttacaat
tattccaaccttacaaccgagcaagctgacgaaaagcgcatgctgctggaacaattccag
aaggaaaaagaggcgttgaaggccgccaaagccgccacgccagccgcagctgcatcagct
ggggccgcaccggctacgactgcaccggcgcgaccggttttcaaaccaaccgcgaagccc
aagccggcagaagagcctgcatctgaaactgccagccaggagccagccgcgccgactcca
aaaccggcattcaaaccggtcatgaagccaaaaaaggcggaagaaaacacaccagctgtc
gatcccgctcctacggaaaagcctaccgccggcaaaccggtattccgccctacattgaaa
ccgaaagtggtatcggaggaaaatgcagagaaaccggttgccgaaacgccagctgaaccg
gcagaaaaaccggttgcggcaaaacctccgttccgcccgaccatgaagccgaaggctgct
tcggaggaaaatgcagagaaaccggttgcggaaacgcctgctgaaccagcagaaaaaccg
gttgcagcgaaacctccattccgcccgacgatgaagccgaaagctgtttcggaggaaaat
gctgagaaaactgtttcggaaacgcctgctgaaccagcagagaaaccggttgcagcgaaa
cctccattccgcccgacgatgaagccgaaagtggttgccgatgataatgcggagaaacca
gttgccgaggctcctgctaaaccggcagagaagccggttgctgcgaaaactccattccgc
ctgacgatgaagccgaaagctgttttggaggaaaatgcagagaaaccggttgaagaagcg
cctgctgaaccaatagagagaccggttgctgccaaacctgcgtttcgcccaactatgaag
ccgaaagtggttgcagaaaataatgcggaaaagcccgttgccgaagtgcctgccgagcca
gctgaaaaaccagttgcagaagccccggcagaaccagcagagaaaccagctgcggcaaaa
ccggcatttcgccccacaatgaaacccaaacccaaggaatag

DBGET integrated database retrieval system