KEGG   Dyadobacter fermentans: Dfer_4040Help
Entry
Dfer_4040         CDS       T00970                                 

Definition
(GenBank) protein of unknown function DUF606
  KO
K09936  bacterial/archaeal transporter family-2 protein
Organism
dfe  Dyadobacter fermentans
Pathway
dfe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Dfer_4040
Transporters [BR:dfe02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Dfer_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMT_YdcZ EamA Phage_holin_3_3 Abhydrolase_9_N
Motif
Other DBs
NCBI-ProteinID: ACT95243
UniProt: C6VZ37
Position
4891450..4891896
Genome map
AA seq 148 aa AA seqDB search
MNWIFLILAFLIGISNAVQSGVNTQLRESINNPILAAMTSFFVGLLVLSIAFACFNQNPV
PSLADLKQVSWTRFMGGVLGAFYVITVIFIVRNIGPANMMCLIIAGQMVTVMTIDHLGLQ
GFAVHQMNLPRILGTILLVAGVYLILKN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaactggattttcctgatcttagcttttcttattggtatcagcaatgccgttcagtcg
ggagtgaacacacagctccgcgaatccatcaataacccgattttggcggccatgacgtcc
tttttcgttgggctgctcgttttgagcattgcatttgcctgcttcaatcaaaaccctgtg
ccgtcgctggccgacctgaaacaagtttcctggacgcgcttcatgggtggcgtgctgggt
gcgttttacgtgatcactgttatttttatcgtccgcaatatcggtccggccaacatgatg
tgcctgatcatcgccgggcaaatggtgaccgtaatgacgatcgatcatcttggtttacag
ggatttgcggtacaccagatgaacctgccacgcattctcgggacgatcctgctcgtcgcc
ggtgtttacctgatcctcaaaaattag

DBGET integrated database retrieval system