KEGG   Dyadobacter fermentans: Dfer_4042Help
Entry
Dfer_4042         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07133  uncharacterized protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_14 DUF4143 AAA_22 AAA RNA_helicase HTH_11 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACT95245
UniProt: C6VZ39
Position
complement(4892492..4893622)
Genome map
AA seq 376 aa AA seqDB search
MEINRSLYKRIIDHLVPNKVNIITGTRRVGKTFLVQKIMADTSFKVLTLEGEDIDAQNLL
AQNSIANYQRLFADYELLVIDEAQAIPDIGKKLKLIVDHVKGLRIIATGSSAFDLAQQAG
EPLTGRAYFHDLYPIAQQELSSTENLLETRQRLEERVIYGSYPELLQLTSLKEKEAYLKD
LVNAYLLKDILSFEGVRNAEKVKDLLRLVAYQVGKEVSFQQLGVSLNISKNTVEKYLDLL
SKVFILRRIGGYSKNLRKEITKSSRWHFHDNGVRNAIINDLRPLALRTDIGELWENYLIS
ERIKKLAYAKRHADFYFWRTYDQQEIDWLEWDNGRLSAFEFKWKDERAKIPAAFANAYPD
ASFELINRDNYLDFIS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagatcaatcgctcattgtataaacggatcattgaccatttagtacctaataaggtc
aatatcatcaccggcaccaggcgggtagggaaaacttttcttgtgcagaaaatcatggca
gatacttctttcaaagtccttacgctggaaggagaggacattgacgcgcaaaatctgtta
gctcaaaatagcatcgccaattatcaacgccttttcgccgactatgaactgttggtgatt
gatgaagcacaagcgattccggacattgggaaaaagctgaaactcatcgtcgatcacgtg
aagggcctcaggatcatcgcgacaggctcctccgcatttgatttggcacagcaggcaggc
gagccgcttacgggcagagcctattttcatgacctttatcccattgcacagcaggagttg
tcttctaccgagaatttgctggaaacgcgccagcgattggaagagcgcgtgatttacggc
agttaccccgaactgcttcaacttacctctttgaaggaaaaagaagcgtatctcaaagat
ctcgtgaatgcatatctcttgaaggatattctctcattcgagggcgttcgaaatgcggaa
aaggtgaaagacctcctgcgattggtcgcttaccaggtaggtaaggaggtatcgttccag
caactgggcgtctcactgaatatcagtaaaaacacagtcgagaaatacctggatcttctt
tccaaagtgttcattttaagacgtataggaggttatagcaaaaatcttcgaaaggagatt
acaaaaagcagccgctggcactttcacgataacggcgtacggaatgcgatcatcaacgac
ctgcggccccttgcattacggacagatatcggtgagctttgggagaattatctgattagc
gaaaggattaaaaagctggcttacgccaaacgccacgcagacttctatttttggagaacc
tacgaccagcaggaaattgactggctggaatgggacaatggacgcttgtcggcatttgag
ttcaaatggaaggatgaacgcgccaaaatcccggccgcatttgccaatgcctaccccgac
gcgagctttgaattgatcaaccgtgacaattatttggattttatttcctaa

DBGET integrated database retrieval system