KEGG   Dyadobacter fermentans: Dfer_4046Help
Entry
Dfer_4046         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHASE3 LMBR1 BssS ICEA IncA
Motif
Other DBs
NCBI-ProteinID: ACT95249
UniProt: C6VZ43
Position
complement(4897349..4897756)
Genome map
AA seq 135 aa AA seqDB search
MNPFLLLIVLTLAAFACSPKSEKSPQLVEANRLHLEAMKISQQLEQKLDSLSPLAKDGSS
EKSQIDSLKNLIEVWEKHVIEVPGFAHEHAHEHGAHEHKTAPPMTDESMLEYQRQSRQAI
AELQEAIEKLESLPK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattccttttactgattgtccttacccttgcggcattcgcctgctcgccaaaa
agcgaaaagagcccgcagctcgtcgaagccaaccgtttgcatcttgaagccatgaaaata
tcgcagcaactcgaacaaaaactcgacagcctgtcgccgctcgcaaaagacggaagttcg
gaaaaatcgcaaatcgatagccttaaaaacctgatcgaagtttgggagaaacacgtaatt
gaagtgccgggcttcgcacacgagcacgcgcatgagcacggcgcacacgagcacaaaaca
gcaccaccaatgaccgacgagtcgatgctggaataccaacggcaatcgcgccaggccatt
gctgagctacaagaagctattgagaaattagaaagcttgcctaaatga

DBGET integrated database retrieval system