KEGG   Dyadobacter fermentans: Dfer_4053Help
Entry
Dfer_4053         CDS       T00970                                 

Definition
(GenBank) Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase
  KO
K13566  omega-amidase [EC:3.5.1.3]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00250  Alanine, aspartate and glutamate metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dfer_4053
Enzymes [BR:dfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.3  omega-amidase
     Dfer_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACT95256
UniProt: C6VZ50
Position
4902406..4903197
Genome map
AA seq 263 aa AA seqDB search
MQEHKEILSIALVQADLHWEDVTANLASFEEKLAALPEAVDVIVLPEMFNTGFTMNTALA
EPMNLTTTRWMKQIAKQQNALVVGSFAVNDGGRFFNRLLCVRPDGTYSQSDKRHLFRMGE
EHSHYTAGNARLTIEWRGWKFCPLVCYDLRFPVWSRNLQSDPYDILFFVANWPARRAHAW
STLLQARAIENQCYVMGVNRVGTDGNGLEYRGDSVALDYLGEPIAMLTNQETEKIVHISK
AELATYREKFPALSDADDFEIRC
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagcataaggaaattctttccatcgcattggtgcaggccgatctgcattgggaa
gatgtgacggccaaccttgcttcttttgaagaaaagctggctgcgttgccggaggcggtc
gatgtgatcgtgctgccggaaatgttcaataccggttttacgatgaacaccgcgctcgcc
gagccgatgaacctcaccaccacgcgctggatgaagcaaattgcgaaacagcagaatgca
ttggtggtaggaagtttcgcggtgaatgacggcggccgcttttttaaccgccttctttgt
gtacgcccggacgggacctattcgcaaagcgacaagcggcatttgttcagaatgggggag
gagcacagtcattacaccgcgggcaatgcacggctgacgattgaatggaggggctggaag
ttctgcccgctcgtttgctatgacctgcgcttcccggtatggagccgtaatctgcaaagt
gacccgtacgacatcttattttttgtagcaaactggcccgcacgccgcgcgcatgcgtgg
agcacgctgttgcaggcgagggcgatcgaaaatcagtgttatgtgatgggcgtaaaccgc
gtcgggaccgacgggaacgggctggaatatcgcggagactccgtggcgctcgattacctg
ggtgaacccattgccatgctcacaaaccaggaaaccgaaaagatcgtgcacatttcgaag
gcggagcttgcgacataccgggagaagtttccggcattgtcggatgccgacgattttgag
atccgctgttga

DBGET integrated database retrieval system