KEGG   Dyadobacter fermentans: Dfer_4055Help
Entry
Dfer_4055         CDS       T00970                                 

Definition
(GenBank) MotA/TolQ/ExbB proton channel
  KO
K03561  biopolymer transport protein ExbB
Organism
dfe  Dyadobacter fermentans
Brite
Transporters [BR:dfe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Dfer_4055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB Phage_GPO DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACT95258
UniProt: C6VZ52
Position
4904138..4904977
Genome map
AA seq 279 aa AA seqDB search
MEKKATSPAPAPKPAAAATKGKGGLNPALVIPLLFAIALCVYIFVLGAPEHFKDGDHEKG
PIDGDYYGIVYKGGPIVPILMTCFLIVLTFTIERLITLNKASGSGSIDAFVRKVRSLLDK
NQIEEAIKECDKQKGSVGNVIKAGLLKYKQLTTETALDKEQKLAALQKEIEEATTLELPM
LQKNLTIIATLAGASTLLALLGTVIGMIKAFAALGTSGSPDSAALATGISEALINTALGI
GTSAIATISYAYLNSRVDDLTYSIDEIGMSLQSNFAAHY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaagctacaagtccggcaccagctccaaagcctgctgcggcagcaactaaa
ggcaaaggcggtttgaacccggcattggtaatccctctactttttgcgattgcactttgt
gtttacattttcgtgttgggagctcccgaacacttcaaagatggcgatcacgaaaaagga
cctatcgatggtgattactacggaatcgtttacaagggtggtcctatcgtaccgatcttg
atgacgtgtttccttattgtattgacctttacaatcgagcgtctgatcactttgaacaaa
gctagcggctcaggcagcatcgatgcattcgttcgtaaagtgagaagcctgcttgacaaa
aaccaaatcgaagaggctatcaaagagtgcgataagcaaaaaggatctgttggtaacgta
atcaaagcgggtcttttgaaatataagcaattgactactgaaactgcgcttgacaaagag
cagaaactggcggctcttcagaaagagatcgaagaagctactacacttgaacttccaatg
cttcagaaaaacctgaccatcatcgctacattggcgggtgcatctaccctcttggcgctt
ttgggaacggtaatcggtatgatcaaggcgttcgcggctttgggtacatcaggttcacct
gactctgctgctcttgcaactggtatctctgaggcccttatcaataccgcattgggtatc
ggtacttcggctatcgcgacaatctcttacgcttacctgaacagccgtgttgacgatctt
acttacagcatcgacgaaattggcatgagccttcagtcgaactttgctgcacattattaa

DBGET integrated database retrieval system