KEGG   Dyadobacter fermentans: Dfer_4059Help
Entry
Dfer_4059         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4907115..4907333
Genome map
AA seq 72 aa AA seqDB search
MREKPLHEKLGDLTSSVMALAYVGGGVFLILSSFSFRLLPIGSVWRYAFAGTLILYGLYR
GYRVLRRNQDES
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgagggagaaaccattgcatgaaaagctcggtgatctgacctcttcggtaatggctctg
gcatacgtaggaggaggggtctttttgatcctctcctccttctcatttagattgttgccg
atcggcagcgtctggcggtatgcttttgctggcacgcttattttatatggcctgtaccgc
gggtacagggtgttgaggagaaaccaggacgagtcatga

DBGET integrated database retrieval system