KEGG   Dyadobacter fermentans: Dfer_4062Help
Entry
Dfer_4062         CDS       T00970                                 

Definition
(GenBank) conserved hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4910209..4910415)
Genome map
AA seq 68 aa AA seqDB search
MASMLEYIKIILQKVSFDRKLFEKELRKAIRMLMPAEIKRLRQWCYDHYATVHLPVLNTC
FERISSLK
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgatgcttgaatacattaaaattattctccagaaagtcagcttcgaccgcaaa
ttatttgaaaaggaactcaggaaagccatccgcatgttaatgccggctgagatcaaaagg
cttaggcagtggtgttatgaccattatgcgaccgttcacttaccagtgttaaatacttgt
tttgagagaatttcttcgttgaaatag

DBGET integrated database retrieval system