KEGG   Dyadobacter fermentans: Dfer_4063Help
Entry
Dfer_4063         CDS       T00970                                 

Definition
(GenBank) hypothetical protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4910519..4911916
Genome map
AA seq 465 aa AA seqDB search
MKLYALLNIFLCFSGIALAQSPENPATIEYGSKNLTLDQPFLISVVLRDVETRPSVIFPE
IKDLEKRSKSATSSVSTVDGRKVVIQTITQEYYARKAGNYLIPEFTLTVNNQRLRSEETM
VVFAKTGEADESALADDVAVTEVDDNSQSVFLSVQTDKKQVYIRQGFAVRISLYIAENAP
VQMEFYRFNEQLQAILKAVRPVNCWEENIGVEELIRRKVTIRGRKYAEYNMYQARLFPIT
TEDIVLPSVKLDMLVTESGGAVNVEKKLVKGFYSRPVTVVVRQLPDHPLRDQVAVGQYSL
KERLSSDLVYPGESVRYMFKVEGVGNIAAIPAPVIQASSSFDIYPPERSQVIRRSYQNVV
GEMTFDYFVVPRKDGEFPLSRYFHWIYFDVEKQKYDTLTSAASLEVRGDDYKLANLSLSG
SSGLYDNLENLDSSRMAIDYKEILKDLTNILIVLLLITMVWVFRK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatatgcgttattaaatatttttttgtgtttttctggtatcgcactggcgcag
tctcccgaaaacccggccaccatcgaatatggctctaaaaacctgacgttggatcagccg
ttcctcatatcggttgtgctgcgggatgtagagacccgcccgtcggtgatcttccccgaa
atcaaggacttggagaaaagaagcaagtcggccacgagttcggtaagtacggttgatggc
aggaaggtggtgatccaaaccattacccaggagtattacgccaggaaagcgggaaattat
ctgatacctgaatttacattgaccgtcaataaccaaagactgcggtcggaggaaacgatg
gttgtgttcgcaaagacaggcgaggcggatgaaagtgcattggcggatgacgtagccgtg
accgaggtggatgataacagtcaatcggtgtttttgtcggtacagacggataaaaagcag
gtttacatacgtcagggcttcgcggtgcggatatcgctttatatcgcagaaaatgcgccg
gttcaaatggaattctaccggtttaatgagcagttgcaggccatattgaaggccgtgagg
ccggtgaactgctgggaggagaacatcggggtagaagagctgatccgacgaaaggtcacg
atccgcggcagaaaatatgccgaatacaatatgtaccaggcacggctctttccgatcacg
acggaggacattgtgcttccgtccgtgaagctggacatgctggtgaccgaaagcggcggg
gcggtgaatgtggagaaaaagcttgtaaagggattctactcgcggccggttacggttgtg
gtaaggcagttgccggaccatcccctgcgtgaccaggtcgccgtaggacagtatagctta
aaagagcggctctcgagcgatcttgtgtatccgggcgaaagcgtgagatatatgtttaag
gtagaaggggtagggaacattgcggccattccggcgccggtgattcaggcaagttcctcg
ttcgatatttaccctcccgagcggagccaggtgatcaggcggagctatcagaatgtagta
ggtgaaatgacgttcgattatttcgtcgtgccccgaaaagatggtgaattcccgcttagc
cgctattttcactggatttatttcgatgtggaaaagcagaaatatgacacgctcacgtcc
gcggcctcgctggaagtgaggggagacgattataaactcgccaacttgtcgctctcgggc
tcttcgggattgtatgataacctcgaaaacctcgacagcagccgcatggcgatcgactat
aaagagattctgaaagatttaaccaacatcctcatcgtgttgttgctgataacaatggtg
tgggtatttagaaagtaa

DBGET integrated database retrieval system