KEGG   Dyadobacter fermentans: Dfer_4069Help
Entry
Dfer_4069         CDS       T00970                                 

Definition
(GenBank) SNARE associated Golgi protein
  KO
K03975  membrane-associated protein
Organism
dfe  Dyadobacter fermentans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc FtsX
Motif
Other DBs
NCBI-ProteinID: ACT95272
UniProt: C6VZ66
Position
4917750..4918409
Genome map
AA seq 219 aa AA seqDB search
MRAGLRLQIMDSIVEFFQYILNSEEIIRTGGLLVITFIVFAENGLFFAFFLPGDYLVFLA
GVFCGTGILDVPILILLTSMLTAAILGSLVGYIFGKYFGDMFENRPDSFFFKKKHIETTR
NYFEKYGSRTLIISRFLPIVRTFAPILAGLVKMPFTSFLVNNVVGGMIWIFTLTGGGYLF
GEKFPWIVDYVQYIILFFLAITTFTVIKGYLNARKEMAE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccggcctaagattacagattatggattcaattgtcgagtttttccagtatata
cttaattcagaggagatcatccgcactggcgggcttctggtgatcacatttattgtattt
gctgaaaacgggttgtttttcgcattcttcctgccgggcgactacctcgtgttcctcgcc
ggcgtgttctgcggcaccggcattctcgacgtacccattctgatcttgctcacaagcatg
ctaaccgccgcgatactgggttcgctggtagggtatattttcggaaagtacttcggcgat
atgttcgaaaaccggcctgattccttcttttttaagaaaaaacacattgaaaccacccga
aattattttgaaaaatacgggagtaggacattgattatcagtcgtttcctgccgatcgtc
cgcacatttgcgcctattcttgctgggcttgtcaaaatgccgtttacttcgttccttgtc
aacaatgtggtgggcgggatgatctggatcttcactttaacgggcggaggttacctgttc
ggggagaaattcccgtggatcgtcgactacgtgcagtacattatattattcttcctcgca
atcaccactttcacggttatcaagggttatctgaacgcccgcaaggaaatggccgaatag

DBGET integrated database retrieval system