KEGG   Dyadobacter fermentans: Dfer_4429Help
Entry
Dfer_4429         CDS       T00970                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00330  Arginine and proline metabolism
dfe00332  Carbapenem biosynthesis
dfe01100  Metabolic pathways
dfe01130  Biosynthesis of antibiotics
dfe01230  Biosynthesis of amino acids
Module
dfe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dfer_4429
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Dfer_4429
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dfer_4429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACT95630
UniProt: C6W2R7
Position
5346333..5347376
Genome map
AA seq 347 aa AA seqDB search
MNPKVSKPILVIKFGTASITLTSGEPDVRIISEIARQVSEIHSQYRIIIVSSGAVGAGKA
YINDYKGTMTQRKAAASVGNPLLVGLYASYFAPNNIYIAQSLCERQHFANRNKFLQLKET
FEELWSNGIIPIVNENDVVSDRELKFSDNDELATLLAVGFGAESLMFCTSVGGLLDEEGR
ILRNVSNVNEVFKFVRTDKSFLGLGGMASKLTFAKLASRMAIRVVIFGMNQQNELLNALK
GEAGTLITPGKSTLSARNRWLGSGGLVSGTLRVDEGASKALLKRKSLLAVGVTEVTGDFE
AGEIIEIYSPDDEMIAVARARETSSAIRSNLKTVNFEVAHANDIVLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcccaaagtgtcaaaacctattctcgtcataaagttcgggacggcctctatcacg
cttacttcgggtgaacctgatgtcaggatcatctcggaaatagcccggcaggtttcggaa
atccattcgcaataccgcattatcatcgtttcatcgggtgcggtgggagctggaaaggcc
tatatcaatgattacaaaggcacaatgacgcagcgaaaggcagccgcgtcggttggtaac
ccgctgctcgtcggcctgtatgcttcctatttcgccccgaataatatttacattgcgcaa
agcctttgcgagcggcagcatttcgcgaaccgtaataaattcctgcaactcaaagagact
tttgaagaactctggtcgaacggcattatcccgatcgtgaacgaaaacgacgtggtaagc
gaccgtgagctgaaattttcggataatgacgagctggccacattactggccgtcggtttt
ggggctgaatcgctcatgttctgcacgtctgtgggcgggttattggatgaagaggggcga
atcctgcggaacgtatccaatgtgaacgaggttttcaagtttgtcaggactgataaatct
ttcctcggcctcggaggaatggcgtccaagctgacttttgccaagctggcttccagaatg
gcaatccgcgtggtgatttttggcatgaatcagcaaaatgagctgctgaatgcattgaaa
ggcgaagcagggacattgattacgccgggcaaaagcacattatcggcgcgtaaccgctgg
ctgggaagcggcgggcttgtatccggcacattgcgtgtggatgaaggcgcgtcgaaagca
ttattgaagcgtaaaagtttgctagcggtgggtgtcaccgaagtaacgggcgattttgaa
gcgggtgaaatcattgaaatatactcgccggatgacgaaatgatcgccgtcgcgcgggcg
cgggaaacttcctcggcgatccgcagcaacctgaaaacagtgaattttgaagtggcgcat
gccaatgatatagttttgttataa

DBGET integrated database retrieval system