KEGG   Dyadobacter fermentans: Dfer_4429Help
Entry
Dfer_4429         CDS       T00970                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dfe  Dyadobacter fermentans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dfer_4429
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Dfer_4429
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Dfer_4429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5346333..5347376
Genome map
AA seq 347 aa AA seqDB search
MNPKVSKPILVIKFGTASITLTSGEPDVRIISEIARQVSEIHSQYRIIIVSSGAVGAGKA
YINDYKGTMTQRKAAASVGNPLLVGLYASYFAPNNIYIAQSLCERQHFANRNKFLQLKET
FEELWSNGIIPIVNENDVVSDRELKFSDNDELATLLAVGFGAESLMFCTSVGGLLDEEGR
ILRNVSNVNEVFKFVRTDKSFLGLGGMASKLTFAKLASRMAIRVVIFGMNQQNELLNALK
GEAGTLITPGKSTLSARNRWLGSGGLVSGTLRVDEGASKALLKRKSLLAVGVTEVTGDFE
AGEIIEIYSPDDEMIAVARARETSSAIRSNLKTVNFEVAHANDIVLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgaatcccaaagtgtcaaaacctattctcgtcataaagttcgggacggcctctatcacg
cttacttcgggtgaacctgatgtcaggatcatctcggaaatagcccggcaggtttcggaa
atccattcgcaataccgcattatcatcgtttcatcgggtgcggtgggagctggaaaggcc
tatatcaatgattacaaaggcacaatgacgcagcgaaaggcagccgcgtcggttggtaac
ccgctgctcgtcggcctgtatgcttcctatttcgccccgaataatatttacattgcgcaa
agcctttgcgagcggcagcatttcgcgaaccgtaataaattcctgcaactcaaagagact
tttgaagaactctggtcgaacggcattatcccgatcgtgaacgaaaacgacgtggtaagc
gaccgtgagctgaaattttcggataatgacgagctggccacattactggccgtcggtttt
ggggctgaatcgctcatgttctgcacgtctgtgggcgggttattggatgaagaggggcga
atcctgcggaacgtatccaatgtgaacgaggttttcaagtttgtcaggactgataaatct
ttcctcggcctcggaggaatggcgtccaagctgacttttgccaagctggcttccagaatg
gcaatccgcgtggtgatttttggcatgaatcagcaaaatgagctgctgaatgcattgaaa
ggcgaagcagggacattgattacgccgggcaaaagcacattatcggcgcgtaaccgctgg
ctgggaagcggcgggcttgtatccggcacattgcgtgtggatgaaggcgcgtcgaaagca
ttattgaagcgtaaaagtttgctagcggtgggtgtcaccgaagtaacgggcgattttgaa
gcgggtgaaatcattgaaatatactcgccggatgacgaaatgatcgccgtcgcgcgggcg
cgggaaacttcctcggcgatccgcagcaacctgaaaacagtgaattttgaagtggcgcat
gccaatgatatagttttgttataa

DBGET integrated database retrieval system