KEGG   Dyadobacter fermentans: Dfer_4464Help
Entry
Dfer_4464         CDS       T00970                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dfe  Dyadobacter fermentans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dfe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5387465..5388055
Genome map
AA seq 196 aa AA seqDB search
MIAYVNGIVTYKDPAYAIIDVNGVGYEVRISLQTYTSLPDIGARCKLVTFLNIREDAHVL
YGFWGNDEKKLFLDLTSISGIGPSTALVMLSSLSSSEIRQGIIDEDLRLIQSIKGIGSKT
AQRVILELRDKIRKEELVSTGPRSVEASSNTLRSEALAALVTLGIPKATAEKSLDAIIKR
EGPSISVENLIKLALR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctacgttaacgggattgtaacttataaagacccagcgtacgctattatcgat
gtcaacggggtgggttacgaggtcaggatttcattgcagacctacacttctctccccgac
attggtgcccggtgcaagctggtaacgtttctcaatatacgggaagatgcccacgtcctt
tacgggttttgggggaatgatgaaaagaagctgttcctggatctgacaagtatttcagga
atcgggccgtctaccgcgctcgtaatgctttcgtcgctctcctcctccgaaatccggcag
ggaattatcgatgaagacctgcgcctgatccagtcgatcaaaggcatagggtccaagact
gctcaacgcgtaatcctcgaactaagagacaaaattcgaaaggaagagctcgtttcaaca
ggccccaggtctgtggaagcgtcgtctaacactctgcggagtgaagcgttggctgcgctc
gttactttgggtattcccaaggctacggcggagaaaagtctggatgccatcatcaagcgt
gagggcccgtctattagcgttgaaaatctaatcaaactggcgttacgataa

DBGET integrated database retrieval system