KEGG   Dyadobacter fermentans: Dfer_4543Help
Entry
Dfer_4543         CDS       T00970                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dfe  Dyadobacter fermentans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dfer_4543
Enzymes [BR:dfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dfer_4543
Peptidases [BR:dfe01002]
 Cysteine Peptidases
  Family C44
   Dfer_4543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5484726..5486594)
Genome map
AA seq 622 aa AA seqDB search
MLVSKYGYIGIKGKKKSRHLGSSYLGAFFSSPKILETEFLSSSFGENSVSVFLSILDGKL
ASNSVGVGALFDVDKKELILTRDLFGRVPFHYTIIDGSTFLFSTSYTSLLTQSAVRRDLK
PDVRRIKSYATVHGDAMTLCNSDTFLTNIKSVLPGHALRLTADTATSVPLLRFRPSKWTH
LVSLEEFGEEFRSCFLNAVRASDKGPHERFASHLSGGMDSSSVSTALRFLYPDHPLLTLY
NKSNTLDSDENLYAQAVAEAIGSEHHELIQSTNDFDLLREYIALSGQPSSKLSSPSSSWT
LMKFAQSHHCDTVFNGVGGDSVVGTGFGATERAFADGNWNVVRQLIEKRVPYFSLSHQYP
KWNQLSFEEKTDIVVQNFLYKQLSNKLMHSSLSEFWRLYNAVSKSFHISHTYFLRRGFTS
LVNKSRRKETSQVMSVIREEMLKQSEEKDFAAMGLLDDPTDQAALRYSFRGVFNRQTLLV
NEQDFASSTHMGMVSSSPFYNHELFELCLAVPDVVKFGDGIGRAHFREGMKGLLVDKVRC
RSTKTPLRSHAQDVVIRMFNDSKELLFDSKTIWEYVDRQKFDHQLSILTNKKIPYNHKVD
TRFHVSKTISLATWLADVVQVD
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtttcgaagtatgggtatataggaattaaaggaaaaaaaaagtcgaggcatcta
ggtagcagctatctaggtgcttttttttcaagtccgaaaatactggaaacggaatttctc
tccagctcgtttggtgaaaattccgtttccgtttttttgtccattctcgatggcaaactt
gcttccaatagtgttggcgtaggtgcattatttgatgtagataaaaaagagctgatactc
acccgcgacctgttcggtcgagtgccgtttcactacaccatcatcgacggctccacattc
ctattttccacgagttacacctcattgctcacccaaagcgccgtaaggcgggatttgaag
cccgacgtccgtcggattaaaagctacgccactgtccatggcgatgccatgacgctttgc
aattcggatacatttttgaccaacatcaaatccgtcttgcccggccatgctctgagactc
accgcagatacggcgacatccgtccctttgttgcggttccggccttcaaagtggactcat
ttagtatcattagaagagtttggtgaggagttccgtagttgctttctcaatgccgtccgg
gctagcgacaaaggtccacacgaacggttcgcttcgcatttgagcgggggaatggactcg
tcgtcagtgagcactgcgctccggtttctttatcctgaccatccactacttacgctttac
aacaagtccaatacgctagacagcgacgagaatctgtatgcgcaagcagtcgcggaagca
atcggctctgaacatcacgagctgatccagtcgacgaacgactttgaccttttaagggaa
tatatcgcgctgtccggccagccttccagtaaactttcgagtccatcttccagctggaca
ctcatgaagtttgctcaatcgcaccactgcgacactgtttttaatggtgtaggcggagat
tctgtggtaggaacgggctttggagcaaccgaacgagcttttgccgatggcaactggaac
gtggtcaggcaactgattgaaaagcgagtcccttatttctccctttcgcaccaatatcca
aaatggaatcagctctcctttgaggagaaaacggatattgtggtgcaaaacttcctttac
aagcaactctccaacaagttgatgcatagctctcttagtgagttctggcgcctttataat
gcggtatcaaagtcattccatatttcacatacctatttccttcgtcgtgggtttacgagc
ctcgttaacaagtctcggcggaaagaaacaagccaggtaatgtcggtaatccgggaggag
atgttgaagcagtcggaagaaaaggatttcgctgcaatgggcctgctggatgatccgacg
gaccaggctgcattgcgttattcatttcgtggcgttttcaacaggcaaacgttgctcgtg
aatgaacaggattttgcttccagcacccacatgggtatggtgagtagctctcctttttac
aatcatgagctgtttgaactctgcctggcagtgcccgatgttgtgaagttcggtgatgga
atcgggcgagctcatttccgtgaaggaatgaagggacttctagtggataaggtgaggtgc
cgaagtactaaaacgccccttaggtcgcacgcacaggacgtagttatccgaatgttcaac
gactctaaagagcttctttttgactcaaaaacgatttgggagtatgtcgacagacaaaag
ttcgaccaccaattgtctatcctgaccaacaaaaaaatcccgtacaatcacaaggttgat
acgagatttcatgtgtccaagaccatttcactggctacctggctcgcggatgtcgtccag
gtagattag

DBGET integrated database retrieval system