KEGG   Dyadobacter fermentans: Dfer_4625Help
Entry
Dfer_4625         CDS       T00970                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dfe  Dyadobacter fermentans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dfer_4625
   00052 Galactose metabolism
    Dfer_4625
   00500 Starch and sucrose metabolism
    Dfer_4625
   00520 Amino sugar and nucleotide sugar metabolism
    Dfer_4625
Enzymes [BR:dfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dfer_4625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5587802..5588665)
Genome map
AA seq 287 aa AA seqDB search
MIRKAVIPAAGLGTRFLPATKSMPKEMLPIIDIPTIQYVVQEAVDSGIEDILIISGKGKR
AIEDHFDRNVELESRLEEKEDLLWFNEMRRLADMANVHFVRQKEANGLGDAIYYARHHVG
NEPFAVLLGDTIMDSVIPVTQQLMDTYEQYGGSVIAVEEVPANKVNRYGIVGGNSLSDSI
LELSTLVEKPAIDKAPSNLAIAGRYVLTPEIFNTIEQTPKGKNNEIQLTDSLLLLLKREN
IFAHHIEGKRHDIGDKLDYLKTTVEFALKRKEFAEPFRKFLVDILNK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtaaagccgttatacctgccgccgggcttgggacccgattcctgccggcaacc
aagtcgatgccgaaggaaatgcttccgattatcgacattcctaccattcaatacgtagtg
caggaagccgttgactcggggattgaagatatcctgatcatttccgggaaaggaaagcgg
gctatcgaggaccatttcgatcgcaatgtggaactcgaaagtcgcctcgaagaaaaggaa
gatctcctttggttcaatgaaatgcgccgtttggcagacatggccaatgtgcatttcgta
cggcagaaagaagccaacggcctcggcgacgccatttactatgcgcgtcaccacgttggt
aatgagccatttgcggtacttttgggcgataccatcatggattcggtgattccggtgacc
cagcagctgatggacacgtatgaacaatacggcggctcggtgatcgcggtggaggaagtg
cctgccaataaagtaaaccgttacggcatcgtaggcggtaactcactcagcgactccatc
ctcgaactgagcacattagtcgaaaagccggctatcgacaaggcaccttccaacctggcc
attgccggccggtatgtgctcacgcccgaaatttttaacaccatcgagcagacgcccaaa
ggcaagaacaacgaaatccaactcaccgactcgctgttgctgcttttgaaacgcgaaaat
attttcgcacaccatatcgaaggcaagcgccacgatatcggcgacaagctggattacctc
aaaacaaccgtcgagtttgcattgaaaagaaaggaatttgctgaaccattccggaaattc
ctcgttgatatcctgaacaaatag

DBGET integrated database retrieval system