KEGG   Dyadobacter fermentans: Dfer_4723Help
Entry
Dfer_4723         CDS       T00970                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dfe  Dyadobacter fermentans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dfer_4723
   00051 Fructose and mannose metabolism
    Dfer_4723
Enzymes [BR:dfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Dfer_4723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5708384..5709712)
Genome map
AA seq 442 aa AA seqDB search
MSILLGEQEYFKGIGKISFEGPETDNPLAYRWYDENRVIAGKTMKDHLRFAVAYWHTFCG
AGLDPFGGPTLFYPWDKKADAVDRAKDKADAAFEFITKLGLPYYCFHDVDVVDYDDDVRT
NEKRLQALTAYLGEKQKASGVKLLWGTANLFGHHRYMNGASTNPDFDVVAHAGAQIKMAL
DATIALGGENYVFWGGREGYMSLLNTDMKREQEHFAQMLKISVAYARANGFKGKFFIEPK
PCEPTKHQYDYDAATVIGFLRQHDLLADFSLNLEVNHATLAGHTFEHELQVAADAGILGS
IDANRGDYQNGWDTDQFPNDIAEWTRALLVILNAGGLQGGGINFDAKRRRNSTDVDDVFH
AHIGGIDTVARALVIADKIIQNGAYDEIRKNRYASFDGGKGADFEKGALKLEDLFELAAT
KGEPATTSGKQEYLENLINRFL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctactcggagaacaggagtattttaagggtatcggaaagatctctttcgaa
ggccccgaaaccgacaacccactggcttaccgctggtacgatgaaaaccgcgttatagcc
ggtaaaacgatgaaagatcacctgcgcttcgcagtggcctactggcatacattctgtggc
gcaggtctggacccattcggcggaccgacgcttttctacccttgggacaagaaggccgac
gccgttgaccgcgccaaagacaaggccgacgccgcattcgaattcatcacgaagctgggc
ctgccctactactgtttccacgatgtggacgtagttgactacgacgacgacgtacgcacc
aacgaaaaacgcctgcaagcattgactgcctatttgggtgaaaaacaaaaggcatcgggc
gtgaaactcctttggggaactgccaacctgttcggtcaccaccgctacatgaacggtgct
tccaccaaccctgatttcgacgtggtagcacatgcaggtgcacaaatcaaaatggctctg
gacgctaccatcgcgttgggcggtgaaaactatgtgttctggggtggccgcgaaggttat
atgagccttctgaacaccgatatgaagcgtgagcaggagcactttgcccaaatgctgaaa
atctccgtggcttatgcccgtgcgaatggcttcaaaggtaaattcttcattgaaccgaag
ccttgcgagcctaccaagcaccaatacgactacgatgcggcaacggtaatcggtttcctt
cgtcagcacgacctgctggccgatttcagcctgaacctcgaagtaaaccacgccacattg
gccggccacactttcgagcacgaactacaagttgctgccgacgcaggcatcctgggctcg
atcgacgccaaccgcggtgactaccagaacggctgggataccgatcagttcccgaacgac
atcgccgaatggacccgcgcattgctcgtgatcctgaatgcaggcggattgcagggaggc
ggtatcaacttcgacgcgaaacgccgccgcaactcgaccgacgtagacgatgtattccat
gcgcacatcggtggtatcgacaccgtggcacgtgcgctggtaatcgccgacaagatcatc
cagaacggcgcttacgacgaaatccgcaaaaaccgctacgcaagcttcgacggcggcaaa
ggtgcagatttcgaaaaaggtgcattgaaactggaagacctgtttgaactggctgctaca
aaaggcgagcctgcaacgacttccggcaagcaggagtacctcgaaaacctgatcaaccgt
ttcctttga

DBGET integrated database retrieval system