KEGG   Dyadobacter fermentans: Dfer_4994Help
Entry
Dfer_4994         CDS       T00970                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dfe  Dyadobacter fermentans
Pathway
dfe00010  Glycolysis / Gluconeogenesis
dfe00620  Pyruvate metabolism
dfe00640  Propanoate metabolism
dfe00680  Methane metabolism
dfe01100  Metabolic pathways
dfe01110  Biosynthesis of secondary metabolites
dfe01120  Microbial metabolism in diverse environments
dfe01130  Biosynthesis of antibiotics
dfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dfer_4994
   00620 Pyruvate metabolism
    Dfer_4994
   00640 Propanoate metabolism
    Dfer_4994
  Energy metabolism
   00680 Methane metabolism
    Dfer_4994
Enzymes [BR:dfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dfer_4994
Lipid biosynthesis proteins [BR:dfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dfer_4994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACT96194
UniProt: C6W7K0
Position
6046152..6048041
Genome map
AA seq 629 aa AA seqDB search
MRIKTFEEYKVAYQQSVDDPEGFWAEVAQHFQWRKPWKKVLSWDFQEARTKWFEGGVMNI
TENALDRHLAERGDQPAIIWEPNNPEDQAVTLTYHVLFEQVCRFANVLKKHGVQKGDRVC
IYLPMVPELAVAVLACARIGAVHSVVFGGFSAKSIADRINDAECTMVITSDGAFRGAKVI
PMKDTVDEALVQCSTVKKVIVMTRTRTPVHMLKGRDLWWEEEVKQVNSVCPAEPMDAEDM
LFILYTSGSTGKPKGVVHTCGGYMVYATYTFANVFQYEPGEVHFCTADIGWITGHSYIVY
GPLCYGATSVVFEGVPTYPDASRFWKIVERHKVNILYTAPTAIRSLMGFGLDFVKGHDFS
SLRKLGSVGEPINEEAWHWYKTNIGGDHCPLVDTWWQTENGGIMISPLAGITPEKPTFAT
LPLPGIQPVLVDESGNEIEGNGVSGNLCIKFPWPGIIRTTYGDHERCRQTYFSTYPGMYF
TGDGCLRDEDGYYRITGRVDDVLNVSGHRIGTAEVENAINMHLGVVESAVVGYPHDIKGQ
GIYAFVIAEQTSEDPDMFRKDIAVTVSRIIGPIAKPDKIQFVSGLPKTRSGKIMRRILRK
ISEGDVSNLGDTSTLLDPAVVEEIKAGKL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaagacctttgaagagtacaaggttgcttaccaacaaagtgtagacgatccc
gaaggtttctgggcggaagtagcccaacattttcaatggcgtaaaccgtggaagaaagtg
ctaagctgggactttcaggaagcgcgtacgaagtggttcgaaggcggcgtgatgaacatc
acggaaaacgcgctggaccgtcatctggccgagcgcggcgatcagccggcgatcatctgg
gagcccaacaatcccgaagaccaggcggtgaccctcacctaccatgttttgtttgaacaa
gtttgccggtttgccaatgtgctcaaaaagcatggtgtgcaaaaaggcgaccgcgtttgt
atatacctgccgatggtgcccgagctggctgtggccgtgctcgcctgcgcacgcattggc
gcggtgcattcggtggttttcggtggtttttccgccaaatccatcgccgatcgcatcaat
gacgccgaatgtacaatggtgatcacctccgacggcgcattccgcggcgcgaaagtgatt
ccgatgaaagatactgtggatgaggcgcttgtgcaatgctctacggtgaagaaggtgatc
gtgatgacgcgtacccgcacgccggtgcacatgctcaaaggtcgcgacctttggtgggaa
gaggaagtgaagcaggtgaactccgtatgcccggccgagccgatggatgccgaggatatg
ctctttatcctttacacatccggctccaccggcaagccgaaaggcgtggtgcatacctgc
ggcggatacatggtgtatgccacttacacatttgccaatgtgttccaatatgagccgggc
gaagtgcatttctgtaccgccgacattggctggatcaccggtcacagctacattgtgtac
ggcccgctgtgctacggcgccacgtccgtggttttcgaaggcgttccgacttacccggat
gccagccgtttctggaaaattgtagaaagacataaagtaaatatcctttacaccgcacct
acggccattcgctcactgatgggctttggtttggatttcgttaaaggacatgatttctca
tcgctgcgcaaactcggatcggtaggggagcctatcaacgaggaagcatggcattggtat
aaaaccaacatcggcggcgaccactgcccgctggtggatacctggtggcagaccgaaaac
ggcggtatcatgatttcgccgctagcaggcattacgcccgaaaaaccgacgttcgcgacc
ctgcctttgccgggcatccagcccgtgctggtggacgaaagcggcaatgagatcgagggc
aacggcgtaagcggtaacctgtgcatcaagttcccgtggcctggcatcatccgcaccacc
tacggcgaccacgagcgctgccgccaaacctacttctcgacctacccgggcatgtatttc
accggcgacggctgtttgcgtgatgaagacggctattaccgcattaccggtcgggtagac
gacgtgctcaacgtttccggccaccgtatcggcacggccgaagtggagaatgcgatcaat
atgcacctgggcgtggtggaatcggccgtagtaggctacccgcacgacattaaaggccag
ggcatttacgcatttgtaattgccgagcagacgtcggaagaccccgacatgttccgcaag
gacatcgcggtgacggtatcccgcatcatcggccccattgccaagccggacaagatccag
ttcgtatccggtctacccaagacccgttccggcaaaatcatgcgccggattttgcgaaaa
atctccgaaggagatgttagcaacctgggcgacacctccacgctccttgaccccgccgtt
gtagaggagatcaaggcaggaaagttataa

DBGET integrated database retrieval system