KEGG   Dyadobacter fermentans: Dfer_5176Help
Entry
Dfer_5176         CDS       T00970                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dfe  Dyadobacter fermentans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dfe00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dfer_5176
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dfer_5176
Enzymes [BR:dfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Dfer_5176
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dfer_5176
Two-component system [BR:dfe02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dfer_5176
Bacterial motility proteins [BR:dfe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dfer_5176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6240723..6244937)
Genome map
AA seq 1404 aa AA seqDB search
MYPESGMAYVVILHLSPDYESHLANVLRQVAQIPVVKVEEDMSIATDHIYVVSPNQHLRM
LDGTITVSQNMHIEDRRAPVDIFFRTLAESHGPHAIAVVLSGTGANGSMGVKRIKENGGA
IFVQNPKEALFNEMPRHTIATDLVDGILSASEIPARLREYRDSLHTVSIPAEARMRPEEQ
QQALREIFTHLRLRTGHDFSNYKRPTLMRRLERRISVRNLDGLPAYAGYLRENPEESRAL
LKDLLISVTNFFRDGRVFSALEEDILPRLIRERKSDESIRIWVTACATGEEAYSIAMLMA
ELTFGVIDAPKVQIFATDIDEGAIITAREGKYTINDAADISPERLQRFFVREGDEYRVRQ
EIREMILFAHQNVLKDPPFSRLDLVTCRNLLIYLNQAAQERVMETFHFALKPGGYLMLGL
SETTDSAGDLFANISREYHIYQSRPVAIRPYPVPENTPLAIPQKRHEPVAVSSSESRHLS
ERANFGDLHHQLIEQYAPPSIIVNEEYDILHLSGKAGRYVHIFGEPSKNLLKLVRPELRL
ELRTALYQAVQRQTNVEARNLRVQIEDKTEVINLHVRPVVEDGSQSRNNPAQGLILVLFE
PTDTPEGPIKSVLTSEEPMAQQLEAELMHVRTQLRSAVEQHETQAEELKASNEELQAMNE
ELRSAAEELETSKEELQSINEELTTVNQELKVKVEEISMTSNNFQNLINSTDLATLFLDR
SLRVNLFTPAARSIFNLIPTDSGRPLSDITNSLDYSGLQEDARKVLETLLPVEREVQTHD
QRVFLTRILPYRTAEDRINGIVLTFVDITRRKAAEEAVRRSEERMRLVFESAKDYAILTL
DLKRQVTSWSPGAQAMTGFTEADILGQPGDILFTPEDQESGQPALEEKIARENGHAENER
WHVRKDGSRYWGSGSMSPLKDDDGKVLGWVKIMRDLTERRAAEEARSFLAAIVESSQDSI
MTVNFDGIITSWNKAAEDLYGYSAAQAIGKPLTMLTLPEDLARVLSDTDKIKHSQRVEIF
DTIRVNKDGREMHLEVVMSPVKDASGRPIGVSTIARDITMRKLAEHEQALKNLTLQQQTE
SMARTGSWEYDRITGNFSWSEGMYQLFGLPIGKPVQPDVYLQKTVRPDQHIAEAFIEWLE
SGEQAFEQVLRIHHLETVKYLKIKGVPLPSQDEVSQKMLGIDWDITDHILAQEQLRQSEA
QLRTLVENTPDVITRWDSDLRLIFANNAFVVKTGQQLEDLLGKNNIQMGQPDDIAKPYMA
SLQKVFRTGHPQEHYNAFPTPDGELTFYSRMVPERGPDDSIQTVLAIARDITDLQNAQLQ
IRQLAENLQAVLDASPAFIALLKAVRKDGSPDEVVDFTLVVGNQKLSTFLGKPLEELLGS
PASLFERLLWGPETLENLREIYLS
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
gtgtatccggaatccggaatggcctatgtggtgatcctgcatctttctcccgattacgaa
agccacctggccaatgtactgaggcaggtcgcgcaaattccggtcgtgaaggtggaagag
gacatgtctatcgcaaccgaccacatttacgtggtttcgccaaaccagcatctgcgaatg
ctggacggcactattaccgtttctcaaaatatgcatatcgaagaccgcagggcgccggtt
gatatttttttcagaaccctggcagagtctcacggcccgcacgcgatcgccgttgtactt
tcagggaccggtgccaacggctcgatgggtgttaagcggatcaaggaaaatggcggggcc
atatttgtccaaaaccccaaagaagcactatttaatgaaatgccgcgccatacaatcgct
actgatctggtagacggcatcctctcggcatctgaaatcccggcccggttacgcgagtat
cgcgacagcctgcatacggtctctatcccggcagaagcgcgcatgcggcccgaggagcag
cagcaagccctgcgcgagatcttcacccacctcaggctgcgcaccggccatgatttttcc
aattacaaaaggccaacgcttatgcgccggctcgaacgcaggatcagcgtcagaaacctg
gatggcctgcctgcttacgcgggctatttacgcgagaatcccgaggaaagcagggcattg
ttgaaggatttactcatttccgtgaccaacttctttcgcgatggaagggtgttttcggct
ttggaagaggacatattgccgcgtctcattcgcgagcggaaatcggacgaatctatccgg
atttgggtgacagcctgcgccacaggagaagaagcgtattcgatcgcgatgctgatggca
gaactgactttcggcgtcatagacgcgcccaaagtacagattttcgctaccgatatcgac
gaaggagccattatcacggcccgggaaggcaagtacacgatcaacgatgccgccgacatc
tctcctgaacgactgcagcgcttctttgtccgcgaaggcgacgaataccgtgtccgccag
gaaattagggaaatgatccttttcgcccatcagaatgtgctcaaagaccctccattctca
cggcttgacctggtaacttgccgaaatctgctgatttatctcaaccaggctgcgcaagaa
cgcgtgatggagactttccattttgcattgaagcccggcggctatctgatgctggggctt
tccgaaacgaccgacagcgctggtgatctgtttgccaatatcagccgtgaataccatatt
tatcaaagcaggccggttgcgatccgtccctatcccgtcccggaaaacacaccgctggcc
ataccccagaaacggcacgagcccgtggcagtttccagcagcgaaagccggcatctcagc
gaaagggccaatttcggggacctgcatcaccagttgattgagcaatatgcgccgccttcc
atcattgtaaatgaggaatatgatattcttcacctgtcgggcaaggcaggcagatatgtg
catattttcggcgaaccgtccaaaaacctcctgaaactcgtcaggcccgaattgcgcctt
gaactgcgcacagcattgtatcaggccgttcaaaggcaaaccaacgtggaagcccgcaat
ctgcgggtgcagatcgaagacaagaccgaagtcattaacctccacgtacgcccggtagtg
gaggatggcagccagtcacgcaataacccggcacagggtttgatcctcgtcctttttgaa
ccaaccgatacgccggaaggccccattaagagtgtgctcacctccgaagagcccatggcg
cagcagctggaagccgagctaatgcacgtcaggacgcagctgcgctcggccgtagagcag
catgagacgcaggccgaggagctcaaagcctccaacgaggaattgcaggccatgaacgag
gagctccgctcagcggccgaagaactcgaaacgagcaaggaagagttgcagtcgatcaac
gaagagctgacgacggtgaaccaggagttgaaggtaaaagtggaagaaatatccatgacc
agcaacaacttccagaacctgatcaactcgactgatctcgcgacattgtttttagaccgc
agcctgcgcgtcaacctcttcacccccgcggcaagatctattttcaacctgatccctacg
gacagcggccggccgttgagcgacatcaccaactcactcgattacagcggcttgcaggaa
gatgcccgcaaagtactcgaaacgctgctgccagtagagcgtgaggtgcaaacgcacgac
cagcgtgttttcctcacgcgcattctcccctaccgcactgccgaggaccggatcaacggc
atcgtgctcacatttgtggatattacaaggcgaaaagcagcagaagaagccgtgaggcga
tccgaggagcggatgcggctggtatttgaaagcgccaaggactatgctatcctgacgctt
gacctgaaaaggcaggtaaccagttggagccccggtgcgcaagcgatgacgggcttcacc
gaagcggatattctcgggcagccaggggacatcctgtttacgcccgaagaccaggagagc
ggccagcccgctttggaagaaaagatagcccgcgaaaacgggcacgccgaaaacgagcgc
tggcatgtgcgcaaagacggcagccggtactggggctccggttcaatgtcacctttgaag
gatgatgatggtaaagtgctgggatgggttaagatcatgcgtgacctcaccgagcgccgc
gccgccgaagaagcacgctcgtttctcgctgccattgtcgaatcatcgcaggattctatc
atgaccgtcaactttgacggcattatcaccagctggaacaaggcagccgaagatctctat
ggctattccgcagcccaggcgatcggtaagccactgactatgctcacactcccggaagac
ctggcccgcgtgctcagcgacaccgataaaatcaagcactcgcaacgcgtcgaaattttc
gatacgatccgcgtaaataaagatgggcgcgaaatgcatttggaggtcgtcatgtcgcct
gttaaagatgcttccggcaggccgatcggtgtatcgacgattgcgcgcgatatcacgatg
aggaagctggccgaacatgagcaagccctcaagaacctcactttgcaacagcaaaccgaa
tccatggcccgcaccggaagctgggaatacgaccggataacgggcaatttcagttggtcg
gaaggcatgtaccagcttttcggactgccgatcggtaaaccagtgcagccggatgtatat
cttcaaaaaaccgtcagacccgatcagcacatcgcggaagcgttcattgaatggcttgaa
agcggtgagcaggctttcgagcaggtgttacgcattcaccatttagaaacggtcaagtat
ctcaaaataaaaggggtacccctgccctcgcaggacgaggtttctcaaaaaatgctgggt
atcgattgggacattacggatcacattctcgctcaggagcagctacggcaaagtgaagcc
cagctcagaacgctcgttgaaaacaccccggacgtgatcacgcgttgggacagcgacctc
aggcttattttcgcgaataatgcttttgtagtcaaaaccgggcagcagcttgaagattta
ttgggtaaaaacaatattcagatgggccagcccgacgatattgccaagccttacatggcc
agtttgcaaaaggttttccgcaccggccatccgcaggaacattacaatgcctttcccaca
ccggacggggaattgaccttctattcacgaatggtacccgagcgtggcccggacgattct
atccagaccgtgctcgccattgcccgggatattaccgacttgcagaatgcccagctgcaa
atccggcagcttgccgaaaacctgcaagctgtgctagacgcctcccctgcattcattgca
ttgctcaaagcggtccgtaaagacggctcgcccgacgaggtcgttgattttacactcgtc
gtaggcaaccagaaactatcaacatttttaggtaaaccactcgaagaactgcttggcagt
ccggcaagcctattcgagcgactgctgtgggggcctgagacgctggaaaatctgcgcgaa
atttacctatcatag

DBGET integrated database retrieval system